Details for Kale Locus Bo5g133620

Position : C5 ( 5`- 41774094 .. 41775971 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133620

Protein [Map View]
MVSARLGMLHYVIDHVYGAFMHRTRITPPFFSRGWGGPKLELLERMAKQLFPMYVEGHNWPPPLVRPVWRTVWETKTARL
REGVFQTPCDDELTAALPPESRTARVAWLVPKNVPPQKMSCVVHLAGTGDHTYDRRLRLGGPLVKQNIATMVLESPLYGR
RRPFLQRGARLLCVSDLLLLGRATIDESRSLLHWLDTEEGFGKMGVCGLSMGGVHASMVGSLHPTPVATLPFLSPHSAVV
AFCEGILKYGTAWEALREELAAQKITMTLDEVRDRMRTVLSLTDVTRFPVPKNPDAVIFVAATDDGYIPKHSVLELQKAW
PGSEVRWVTGGHVSSFILHNDEFRRAIVDGLDRVEWKES*

DNA
ATGGTATCCGCCAGATTGGGAATGCTCCACTACGTAATCGACCACGTCTACGGAGCCTTTATGCACCGCACGAGGATAAC
GCCTCCCTTCTTCTCCCGAGGCTGGGGCGGTCCCAAGCTCGAGCTCCTCGAGCGGATGGCTAAGCAGCTCTTCCCTATGT
ACGTCGAAGGTCACAATTGGCCGCCGCCGTTGGTCCGTCCCGTGTGGAGGACCGTCTGGGAGACGAAGACCGCTCGTCTC
AGAGAAGGCGTTTTCCAGACTCCATGTGACGACGAGCTTACCGCTGCTCTGCCTCCAGAGTCTCGCACGGCCAGAGTTGC
TTGGCTTGTTCCTAAAAACGTTCCTCCCCAGAAGATGTCATGTGTCGTTCATCTTGCAGGCACAGGTGATCATACATATG
ACAGGAGATTGCGTTTGGGTGGACCTTTGGTGAAGCAAAACATTGCAACCATGGTGCTAGAAAGCCCTTTATATGGCCGA
AGGCGTCCGTTTCTACAGCGTGGAGCGAGGCTTCTATGTGTTAGCGATCTTCTTTTACTTGGGAGGGCAACGATTGATGA
GTCCCGCAGTCTTCTCCACTGGCTAGACACTGAGGAAGGCTTTGGAAAGATGGGTGTTTGTGGGCTTAGTATGGGAGGAG
TACATGCTTCGATGGTTGGATCGCTTCATCCAACACCAGTTGCAACGCTTCCTTTCCTGTCTCCGCACTCTGCAGTTGTT
GCATTCTGCGAAGGAATACTAAAGTATGGAACGGCTTGGGAGGCGCTGAGGGAAGAGCTTGCGGCGCAGAAGATCACAAT
GACTCTTGATGAAGTCAGAGATAGGATGAGAACTGTGCTCTCCCTCACAGATGTCACTCGCTTCCCTGTCCCCAAAAACC
CTGATGCTGTCATCTTTGTTGCTGCAACTGATGATGGATACATACCGAAGCACTCTGTGTTGGAGCTTCAAAAGGCGTGG
CCTGGTTCAGAAGTGAGATGGGTTACAGGTGGACACGTCTCCTCCTTTATTCTCCACAACGATGAGTTTCGCAGGGCAAT
AGTGGACGGTCTCGATAGAGTAGAGTGGAAGGAGTCATAG