Details for Kale Locus Bo5g133610

Position : C5 ( 5`- 41771603 .. 41772848 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133610

Protein [Map View]
MSNLQGDYNQKIDYVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIWDTAGQERYRAV
TSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDLGSLRAVPTEDAQEFAQRENLFFMETSAL
EATNVETAFLTILTEIYRIISKKTLTADDDDADGNSSLLKGTRIIIPSEQETGKRGGCCGKS*

DNA
ATGTCTAATCTGCAAGGAGATTACAACCAAAAGATCGATTATGTATTCAAAGTGGTGTTGATCGGTGATTCCGCCGTTGG
CAAAACTCAGCTGCTGGCTCGGTTCGCTAGGAACGAGTTCAGCGTCGACTCTAAAGCCACCATCGGTGTCGAGTTCCAGA
CTAAAACGCTCGTCATCGATAACAAAACCGTCAAAGCTCAGATTTGGGATACCGCTGGCCAAGAAAGATACCGAGCGGTG
ACAAGTGCATACTACCGTGGAGCTGTTGGGGCAATGTTGGTCTATGACATGACCAAACGTCAATCATTTGATCACATGGC
TAAATGGCTGGAAGAATTAAGAGGACATGCGGACAAAAACATAGTCATTATGCTTATTGGAAACAAATGTGATCTTGGAA
GCTTAAGAGCAGTGCCAACAGAAGATGCACAAGAGTTTGCACAGAGAGAGAACTTGTTCTTCATGGAAACATCTGCTCTC
GAGGCTACCAATGTCGAAACCGCGTTTTTGACCATCTTAACAGAGATTTATCGAATAATCAGTAAGAAAACCTTAACGGC
TGATGATGATGACGCTGATGGGAATTCAAGTCTTTTAAAGGGGACTAGGATCATCATTCCGAGTGAGCAGGAGACTGGGA
AAAGAGGTGGATGTTGCGGCAAATCGTAA