Details for Kale Locus Bo5g133550

Position : C5 ( 5`- 41751846 .. 41753733 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133550

Protein [Map View]
MADTSSRTDASTDGYTDPRDLGSERGQMMLAGASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKL
TQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEYSRWLEEKNRQMNELRSALNAHAGDTELRTIVDGVMAHYEEL
FRIKSNAAKNDVFHILSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVVGINSLQQTSQQAEDALSQGMESLQ
QSLAETLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYSSRLRA
LSSLWLARPRE*

DNA
ATGGCTGATACCAGTTCAAGGACTGATGCCTCAACTGACGGCTACACAGATCCTAGAGATCTGGGGTCCGAGAGAGGGCA
AATGATGCTTGCCGGTGCTTCTGATTCCAGTGATCGATCAAAAGATAAGTTGGATCAAAAGACCCTTCGTAGGCTTGCTC
AAAATCGTGAGGCAGCAAGGAAAAGTAGACTGAGGAAGAAGGCGTATGTTCAGCAGCTGGAGAACAGCCGATTGAAGCTG
ACTCAACTTGAGCAAGAGCTGCAAAGAGCAAGGCAGCAGGGAGTTTTCATCTCAAGCTCTGGAGACCAAGCCCATTCTAC
AGGTGGAAATGGGGCTTTGGCATTTGATGCCGAATATTCACGATGGCTTGAAGAAAAGAACAGGCAAATGAACGAGCTGA
GATCTGCTCTGAATGCTCACGCTGGTGATACCGAGCTCCGGACAATTGTGGATGGAGTGATGGCTCACTATGAGGAGCTT
TTCAGGATTAAAAGCAATGCAGCTAAGAACGATGTCTTCCATATACTATCTGGAATGTGGAAAACGCCAGCTGAGAGATG
TTTCTTGTGGCTTGGCGGGTTCCGTTCATCAGAACTTCTCAAGCTTCTTGCGAATCAGCTGGAGCCAATGACAGAGCGAC
AGGTGGTGGGCATCAACAGCTTGCAGCAGACGTCCCAGCAGGCTGAAGATGCGTTATCTCAAGGGATGGAGAGTTTACAG
CAATCGTTAGCTGAGACTTTGTCTAGTGGAACTCTTGGTTCAAGTTCGTCTGATAATGTTGCGAGCTACATGGGTCAGAT
GGCCATGGCGATGGGGCAGTTAGGTACACTTGAAGGATTTATCCGCCAGGCTGATAACTTGAGGCTGCAAACACTGCAAC
AGATGATTAGAGTGTTAACAACGCGTCAGTCAGCTCGTGCTCTTCTTGCTATACATGATTATTCATCTCGACTACGGGCC
CTTAGTTCCTTGTGGCTTGCCAGGCCAAGAGAGTGA