Details for Kale Locus Bo5g133540

Position : C5 ( 5`- 41750115 .. 41751339 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133540

Protein [Map View]
MAAPFTLRKIGVPPNSANLTEARRRVFDFFRAACRSLPTVMDIYNLQDVVAPSQLRFAISAQIRNNAHVTDPKVIDLLLF
KGMEELTDIVDHAKQRHHIIGQYVVGEGLVQNTGSKDRGKSDFLKNFYTSNYF*

DNA
ATGGCAGCACCTTTCACGTTGAGGAAGATCGGAGTTCCGCCGAACTCAGCTAACCTGACGGAGGCTCGCCGCCGTGTTTT
CGATTTCTTCAGAGCTGCGTGTAGATCCCTCCCCACCGTAATGGACATTTACAATCTACAAGATGTCGTCGCGCCTTCTC
AGCTCCGCTTTGCGATCTCTGCTCAGATTCGTAATAACGCTCACGTCACCGATCCTAAGGTAATTGATCTTCTGTTATTC
AAGGGAATGGAAGAGCTTACTGACATTGTGGATCACGCAAAGCAGCGTCACCACATTATTGGTCAGTACGTGGTGGGTGA
AGGGCTCGTCCAGAATACTGGAAGCAAGGATCGAGGGAAGTCTGATTTTCTCAAGAACTTCTACACCAGCAACTACTTTT
GA