Details for Kale Locus Bo5g133510

Position : C5 ( 5`- 41739383 .. 41741003 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133510

Protein [Map View]
MASSDQTAKIIDGKAIAHTIRLEIAEEVRDLSEKHGKVPGLAVVIVGARKDSQTYVNMKRKACAEVGIKSVDVDLPEDVS
EADLISKVHQLNSDPDVHGILVQLPLPKHINEENVLSAISIDKDVDGFHPLNIGKLAMKGREPLFLPCTPKGCLELLKRS
GVKIKGQRAVVVGRSNIVGLPVSLLLLKADATVTTVHSHTKDPEAIIREADIVIAAAGQACMIKSDWIKPGAAVIDVGTN
AVSDPSRKSGYRLVGDVDYAEACKVAGCITPVPGGVGPMTVAMLLRNTLDGAKRVIGQ*

DNA
ATGGCTTCATCTGATCAAACGGCGAAGATAATCGATGGAAAGGCGATTGCTCATACCATCCGATTAGAGATCGCCGAGGA
AGTTCGCGATCTATCTGAGAAACACGGCAAGGTCCCAGGACTAGCGGTGGTTATAGTTGGTGCACGGAAAGATTCACAAA
CTTATGTGAATATGAAGAGGAAAGCGTGTGCTGAGGTTGGGATCAAATCAGTTGATGTGGACCTACCAGAGGATGTTTCT
GAAGCTGATCTTATCAGCAAAGTTCATCAACTCAATTCAGATCCTGATGTCCACGGTATATTAGTTCAACTCCCGTTGCC
GAAACATATCAATGAGGAGAATGTTTTAAGTGCAATCAGCATTGATAAAGATGTAGATGGCTTCCATCCTCTGAATATTG
GTAAGCTAGCCATGAAAGGCAGAGAGCCCCTCTTCCTTCCATGCACCCCAAAGGGATGTTTGGAACTCTTAAAGAGAAGT
GGCGTAAAGATAAAAGGGCAACGAGCAGTTGTAGTAGGTCGCAGCAACATTGTTGGATTACCTGTTTCGCTTCTATTGCT
CAAGGCTGATGCTACTGTTACAACCGTACATTCTCACACCAAAGATCCTGAGGCTATCATACGCGAAGCTGACATCGTTA
TTGCTGCAGCCGGACAAGCCTGCATGATTAAGAGCGACTGGATTAAGCCAGGTGCTGCGGTGATCGATGTTGGAACTAAT
GCAGTGAGCGACCCGAGCAGGAAGTCAGGATACCGGTTGGTTGGAGATGTTGATTACGCAGAAGCTTGTAAAGTTGCAGG
TTGCATAACTCCTGTCCCTGGTGGTGTAGGTCCAATGACAGTGGCGATGCTGCTGAGGAACACCTTAGACGGTGCCAAGC
GGGTCATTGGCCAGTAA