Details for Kale Locus Bo5g133500

Position : C5 ( 5`- 41730109 .. 41731379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133500

Protein [Map View]
MDCYSGMKFEELAVPNYQESSSSETYRSDGMWGGWSMNSPEAAETCFNYDGFSGEGSLYSQMGMRTSEEEEESKRSKAFY
GASSLHDFEGIEHMDDIFLSSILEDVPGNDGDVHQASSSYNSVGSSSLYGGNEVHMFHCHDMPLKEEAPFTISDLSEENM
LNPQYGDELSSEELVLNDLQRASEKLTDDTRKCFRDTFYRLARNSQEKFDSVSTNSEELYMQASRYAYGDSARMSREEEI
ESETNSIDRAVANLTYNKMESNISSFPLSERVH*

DNA
ATGGATTGTTATTCCGGAATGAAGTTTGAAGAGCTTGCTGTGCCCAATTATCAAGAGTCATCGTCATCAGAGACATACCG
TTCTGATGGTATGTGGGGTGGGTGGAGCATGAACTCCCCTGAAGCTGCAGAAACATGTTTTAATTACGATGGTTTCAGTG
GAGAAGGATCGTTGTATAGTCAGATGGGTATGAGGACGAGTGAAGAAGAGGAAGAGTCCAAGAGATCAAAGGCTTTCTAC
GGTGCTTCTTCACTTCATGATTTCGAAGGAATCGAACACATGGATGATATATTCTTAAGTTCAATTTTGGAGGATGTTCC
AGGGAATGATGGAGATGTTCATCAAGCTTCCAGCAGCTACAACAGTGTCGGATCTTCCTCTTTGTATGGTGGAAATGAAG
TTCACATGTTCCATTGTCATGACATGCCTTTGAAGGAGGAGGCTCCATTTACAATCTCGGATCTGTCTGAGGAGAACATG
TTAAATCCACAGTATGGGGATGAACTATCTTCGGAGGAACTGGTGTTGAACGATCTGCAAAGAGCTTCTGAAAAGTTAAC
TGATGATACAAGAAAGTGCTTCCGTGATACGTTTTACCGGCTTGCAAGAAACTCACAGGAGAAGTTTGATTCAGTCAGCA
CCAACTCAGAAGAGTTATATATGCAAGCATCCAGATATGCTTATGGTGATAGTGCCAGGATGAGTAGAGAGGAAGAGATT
GAATCTGAGACGAACTCAATCGATAGAGCCGTCGCAAACCTCACATACAACAAGATGGAATCCAACATAAGCAGCTTTCC
TCTATCAGAAAGAGTACATTAG