Details for Kale Locus Bo5g133490

Position : C5 ( 5`- 41728584 .. 41729111 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133490

Protein [Map View]
MAITPLRITTPIPSLSFLPTGKPHASKLFTVRATDVESTEETPQPDSDTEDFESRLSNIRLRYRSGTGKKAEVRKSKKGS
AGPPSGLYLPPVSLKEPVSGGLKVELGFTPYTERLNGRMAGLGLAALLLVELATGKSLLSYHTPSVVWLQVYFMAAVSAM
FVKIEKEKVSVWPKD*

DNA
ATGGCGATAACACCTCTACGAATCACGACCCCTATCCCATCTCTGAGCTTCCTTCCAACCGGAAAGCCACACGCTTCAAA
GCTCTTCACCGTCCGCGCCACCGACGTCGAATCAACGGAAGAGACTCCTCAACCCGACTCAGACACCGAAGACTTCGAGT
CACGTCTCTCGAACATCCGTCTCAGATACCGAAGCGGAACCGGGAAGAAAGCAGAGGTTAGAAAGTCTAAGAAAGGCTCA
GCAGGGCCACCGTCGGGGCTTTACTTGCCGCCGGTGAGTTTAAAGGAGCCGGTTTCGGGCGGGTTGAAGGTGGAGTTGGG
GTTTACGCCTTACACCGAGCGGCTCAACGGGAGGATGGCGGGGTTGGGGCTCGCGGCTTTGCTTCTGGTTGAGCTGGCGA
CGGGGAAGAGCTTGCTGAGTTACCACACGCCTTCAGTTGTGTGGCTTCAGGTGTATTTCATGGCGGCTGTTTCGGCTATG
TTTGTTAAGATTGAGAAGGAGAAGGTTAGTGTCTGGCCTAAGGATTAA