Details for Kale Locus Bo5g133470

Position : C5 ( 5`- 41723095 .. 41723607 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133470

Protein [Map View]
MASLRRALLVAGKTKLNLQNCHFITGINYNGLTVKQLQELRGILRENSNTKLLVAKNTLVFKALEGTKWESLKPCMKGMN
AWIFVQTEDIPAALKTFVSFQKEKKLFDNNLGGAVFEEKLYAPQDYKVIETMPSREDVYGMMFGALHWPGLDLVNTLEAP
AASENESAAA*

DNA
ATGGCCAGCCTCAGAAGAGCTCTCCTCGTCGCAGGCAAGACGAAGCTCAACCTCCAGAACTGCCACTTCATCACCGGGAT
CAACTACAACGGCCTCACCGTGAAGCAGCTCCAAGAGCTCCGCGGGATCCTCCGCGAAAACAGCAACACGAAGCTCCTCG
TTGCCAAGAACACTCTAGTCTTCAAGGCCCTGGAAGGAACCAAATGGGAGTCTCTGAAGCCGTGTATGAAAGGCATGAAC
GCTTGGATCTTTGTTCAGACCGAAGATATCCCCGCGGCTCTTAAGACGTTCGTCAGTTTCCAGAAGGAGAAGAAGCTCTT
CGACAACAACTTGGGAGGTGCCGTGTTCGAGGAGAAGCTGTACGCTCCTCAGGATTATAAGGTTATTGAAACGATGCCGT
CTCGGGAAGATGTGTATGGGATGATGTTTGGGGCTTTGCATTGGCCGGGGTTGGATCTCGTCAATACGTTGGAGGCGCCG
GCTGCGTCGGAGAATGAGAGTGCTGCTGCTTAG