Details for Kale Locus Bo5g133460

Position : C5 ( 5`- 41719364 .. 41722566 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133460

Protein [Map View]
MPIVSKTRRQTDYNLFPPSVPIVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKATGETVTIVGDQDPAMMKFFDCTRS
GPRSAFDSNVVYQFEIMEYILDLAFDRLGASGSAIDHPILITECVGNPVYSRSKMAELLFETYGVPSVAFGVDAAFSYKY
NQRHGKCQKDGIVICPGFTTTHTIPFVDGEPVYKGSCRTNIGGYHVTDYLKQLLSLKYPFHSSIFTWEKAEELKLEHCYI
APDYVSEARKFQEGTKEAEEKTRYWQLPWIPPPIEVPPSEEEIARKAAIREKQGQRLREMAEAKRSSKINEMENELHSLH
FLVKQLDQVEEDDIPSFLSDTGYTSRQELESTVSKVTQALRKARGEPKDEADEFEENTDSNEKYPLINVPDNMLTPEQIK
DKKKQLFLKTTTEGRLRARQKRNEEELEKERRNQLEEERRRENPEFYLEEMRAQYKEVLERVEQKKRLKTNGSNTNGNQK
SGNVGRGERLSAAKRERMRLLTTAAFDRGKGEDTFGAKDEDWQLYKLMSKDHDEDDERPDSDEAELARLSSRLQEIDPTF
ELKAEGEPGQASGEAPRVRPLTEEDYKIVIGVERFRCPEILFHPNLVGIDQVGLDEMAGASIRRLPHDDKELEERLTSSI
LMTGGCSLVPGMKERLECGIRMIRPCGSTINVVQAKDPVLDAWRGASAFAADLNFLGNAFTKKDYYEKGEEWLRRYQIRY
NTL*

DNA
ATGCCGATCGTCTCGAAGACACGTAGGCAGACTGACTACAACCTCTTTCCACCTTCGGTTCCCATTGTTATCGATAATGG
CGCCTCCTACTTCCGGATCGGGTGGGCAGGCGAAACTGAGCCTCGTGTTGTTTTCCGCAATATCGTGCAAAGGCCACGCC
ACAAAGCTACAGGGGAAACTGTTACCATTGTTGGGGACCAGGATCCTGCGATGATGAAGTTCTTTGATTGCACTCGCTCA
GGACCTCGTTCGGCTTTTGACAGCAATGTTGTTTATCAATTCGAGATCATGGAATATATCCTTGACTTGGCCTTTGATCG
TTTGGGGGCTAGTGGATCAGCGATCGATCACCCAATCCTGATTACAGAATGCGTTGGCAACCCAGTTTATTCTCGTAGCA
AAATGGCAGAACTTCTATTTGAGACTTATGGAGTGCCTTCAGTTGCATTTGGAGTGGATGCTGCTTTCAGCTACAAGTAC
AACCAACGACATGGGAAATGTCAAAAAGATGGAATTGTTATCTGTCCTGGCTTCACTACAACACACACCATTCCGTTTGT
CGACGGAGAACCTGTTTATAAAGGATCCTGCAGAACTAACATTGGTGGATATCATGTCACTGATTATTTAAAGCAGCTTC
TGTCACTCAAGTACCCTTTTCATTCGTCTATATTTACATGGGAGAAGGCAGAAGAGTTGAAACTGGAGCACTGTTACATC
GCTCCTGATTACGTTTCTGAAGCTCGAAAATTCCAGGAAGGAACAAAGGAAGCTGAAGAGAAAACAAGGTACTGGCAGCT
TCCATGGATACCTCCACCCATCGAAGTCCCTCCATCAGAAGAAGAGATCGCGAGGAAAGCAGCTATAAGAGAGAAACAAG
GACAAAGGCTGCGAGAAATGGCCGAAGCAAAGAGATCGTCCAAGATAAACGAAATGGAAAACGAACTGCACAGCTTGCAC
TTCCTTGTGAAGCAACTTGACCAGGTTGAAGAAGATGACATTCCGTCTTTTTTGTCAGACACTGGTTACACGTCCAGGCA
AGAGCTGGAGTCTACTGTCTCGAAGGTGACACAGGCCCTTCGAAAAGCAAGGGGTGAGCCGAAGGATGAAGCTGATGAGT
TCGAAGAGAACACTGACTCTAACGAAAAGTATCCTCTTATAAACGTCCCTGACAATATGCTTACGCCTGAGCAGATTAAG
GACAAGAAAAAGCAGCTATTTCTTAAAACGACAACAGAGGGACGGCTAAGAGCTAGACAAAAGCGTAATGAGGAGGAACT
GGAGAAAGAGAGAAGAAATCAATTAGAGGAGGAGAGACGTCGTGAGAATCCAGAGTTCTACTTAGAGGAGATGCGAGCTC
AGTACAAGGAAGTGTTGGAGAGAGTCGAGCAAAAGAAACGGCTGAAAACAAACGGATCGAACACAAACGGGAATCAAAAA
TCTGGAAACGTTGGACGAGGGGAACGACTAAGCGCTGCAAAGAGAGAAAGAATGCGTCTGCTAACGACAGCAGCCTTTGA
CAGAGGCAAAGGAGAGGATACTTTCGGTGCTAAAGACGAAGATTGGCAGCTCTACAAGCTTATGAGCAAGGATCACGACG
AAGACGACGAACGGCCTGACTCAGACGAGGCTGAGCTGGCTCGTTTATCGTCCAGGCTCCAGGAGATAGACCCGACGTTC
GAGCTGAAAGCGGAAGGAGAGCCGGGTCAGGCATCAGGGGAGGCGCCACGTGTTCGTCCACTAACGGAGGAAGACTACAA
GATAGTGATTGGTGTCGAGAGATTCAGGTGTCCTGAGATCTTGTTCCACCCTAACCTCGTTGGGATTGACCAAGTGGGGT
TAGACGAGATGGCCGGTGCATCTATCAGAAGGCTACCGCACGATGATAAAGAGTTGGAGGAGAGGCTAACGAGCTCGATA
CTGATGACCGGTGGGTGCAGCCTTGTCCCGGGGATGAAGGAGCGGTTGGAATGTGGGATAAGGATGATAAGACCGTGTGG
ATCAACCATAAATGTGGTTCAAGCTAAGGATCCAGTGCTGGACGCGTGGCGTGGAGCATCTGCGTTTGCTGCTGATCTGA
ACTTCTTGGGGAATGCGTTTACCAAGAAGGATTACTACGAGAAAGGTGAAGAGTGGCTTCGAAGATACCAGATTCGATAC
AACACTTTGTGA