Details for Kale Locus Bo5g133420

Position : C5 ( 5`- 41702992 .. 41704379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133420

Protein [Map View]
MLYYKYLYLPKDTIKLKAKMKSCLLLFLIFSFLLSFSLAEQCGRQAGGALCPNGLCCSEFGWCGDTEPYCKQPGCQSQCG
GTPPGPTGDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGW
ATAPDGPYSWGYCFKQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQCGRAIGSDLLNNPDLVSNDPVIAFK
AAIWFWMTPQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDDRVADRIGFYQRYCNILGVNPGG
NLDCYNQRSFASVNFFLDAAI*

DNA
ATGTTGTACTATAAATACCTCTACTTGCCTAAAGATACCATAAAACTCAAAGCAAAAATGAAGTCTTGTCTACTTCTCTT
TCTCATCTTCTCATTTCTTTTATCATTTTCCTTAGCCGAGCAATGTGGTCGACAAGCGGGAGGAGCTCTCTGCCCCAACG
GTCTATGCTGCAGCGAGTTCGGATGGTGCGGTGACACCGAACCTTACTGTAAGCAGCCTGGCTGCCAAAGCCAGTGCGGT
GGTACTCCTCCTGGCCCCACCGGTGATCTTTCAGGCATCATTTCAAGATCTCAGTTCGACGACATGCTTAAACATAGAAA
TGATAATGCTTGTCCCGCTAGAGGTTTCTACACTTATGATGCCTTTATCAATGCCGCTAAGTCTTTCCCTGGCTTCGGCA
CCACCGGAGACACTGCCACAAGGAAGAAAGAAATCGCTGCCTTCTTTGGTCAGACTTCCCACGAGACCACCGGTGGGTGG
GCCACAGCACCAGACGGACCATATTCATGGGGATACTGTTTCAAACAAGAGCAGAACCCTTCTTCAAACTACTGTTCACC
GAGTGCCGAATGGCCATGCGCATCTGGTAAAAGCTACTACGGAAGAGGACCAATGCAGCTATCATGGAACTACAACTACG
GACAGTGTGGAAGAGCCATCGGATCTGACTTACTCAACAACCCTGACCTTGTCTCCAACGATCCAGTGATCGCTTTCAAA
GCCGCGATTTGGTTTTGGATGACACCTCAGTCTCCAAAACCGTCGTGCCACGCTGTTATCGTTGGCCAGTGGCAGCCTTC
AGATGCTGACCGTGCTGCTGGAAGAGTACCGGGTTACGGTGTGATTACGAATATTATTAACGGTGGTTTAGAGTGTGGAC
GCGGCCAAGACGATAGAGTCGCGGATAGAATTGGATTTTACCAGAGGTACTGTAACATTCTTGGAGTTAATCCTGGAGGT
AACCTTGACTGTTATAACCAAAGGTCCTTTGCTTCTGTTAATTTCTTCCTTGACGCTGCTATTTAA