Details for Kale Locus Bo5g133410

Position : C5 ( 5`- 41690428 .. 41691729 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133410

Protein [Map View]
MASSEISGCMMEDIRDVRLHKLETNLGSFQGTSAVKIPNVSAMEVNLVRPFVRRAFKASYKHYKPEANAYRDSRSSRLPR
EANNEPRRPLRAAALMNPRLGFIM*

DNA
ATGGCTTCTTCTGAGATATCTGGATGCATGATGGAGGACATCAGAGACGTGCGGCTTCACAAACTTGAGACTAACTTGGG
ATCATTCCAAGGTACATCTGCAGTAAAGATCCCTAATGTATCGGCAATGGAAGTAAACCTAGTCCGCCCGTTTGTGAGAA
GAGCCTTTAAAGCGTCTTATAAGCATTACAAGCCGGAGGCTAATGCATACAGAGACAGTAGAAGTAGTAGACTACCTCGT
GAAGCTAATAATGAACCAAGGAGACCTCTAAGGGCAGCCGCATTAATGAACCCCCGGTTGGGGTTCATCATGTGA