Details for Kale Locus Bo5g133370

Position : C5 ( 5`- 41660577 .. 41665156 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133370

Protein [Map View]
MCDLVARTGRLQQRYKDGSRLIAGCIPFRYIKDGNSESGKVVQVLMISSSSGPGLLFPKGGWENDETVKEAAVREAVEEA
GVRGILMDFLGDYEFKSKTHQDEFSPEGLCKAAMYALYVKEELETWPEQETRTRTWLTIGEAVESCRHAWMKDALVEGFC
KWHKEKMGKGDED*

DNA
ATGTGTGATTTGGTCGCGCGTACGGGTCGGCTCCAGCAACGGTACAAGGATGGTTCGCGTCTCATTGCCGGATGTATTCC
GTTTAGGTATATAAAAGATGGTAACTCTGAATCTGGGAAAGTTGTTCAAGTGTTGATGATCAGCTCTTCTAGTGGACCTG
GACTTTTGTTTCCCAAGGGTGGATGGGAGAATGATGAGACTGTCAAAGAAGCTGCGGTTAGGGAAGCTGTGGAAGAAGCA
GGAGTCCGTGGCATTTTGATGGATTTCTTGGGAGATTATGAGTTCAAGAGCAAAACACACCAAGATGAGTTTAGCCCTGA
AGGTTTATGTAAAGCGGCAATGTACGCCTTGTATGTCAAGGAAGAGCTAGAGACGTGGCCGGAACAGGAGACGAGAACAA
GGACATGGCTGACTATTGGAGAAGCTGTGGAGAGTTGCAGGCACGCTTGGATGAAAGACGCGTTGGTCGAAGGATTCTGT
AAATGGCATAAGGAGAAGATGGGTAAAGGAGATGAAGATTGA