Details for Kale Locus Bo5g133220

Position : C5 ( 5`- 41561047 .. 41562343 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133220

Protein [Map View]
MSRTETMGLTKRGTLQSSSCNRLMGRSESLKRDSVMSNGGSAKVRGSLERKKSKSFKEGESYPSWLITEAPGSIAAVRRE
QVAAQQALRKLKIAHYGRSKSTLTNFTSSKVVPLVHPSPHPHPQRCSFITPTSDPIYVAYHDEEWGVPVHDDKTLFELLT
LSGAQVGSDWTSTLRKRHDFRKAFMEFEAEAVAKISEKEMNEISTEYKIEMSKVRGIVENATKILEIKKNFGSLEKYIWG
FVNHKPISTNYKFGHKIPVKTSKSESISKDMVRRGFRYVGPTVVHSFMQAAGLTNDHLLTCYRHIPCTLFSTNP*

DNA
ATGAGCAGAACGGAGACGATGGGTTTGACCAAAAGAGGAACGTTGCAGTCAAGTAGTTGCAATCGCCTTATGGGCCGTTC
TGAGTCCCTCAAAAGGGACAGTGTGATGAGCAATGGTGGTTCAGCTAAAGTGAGAGGAAGCTTGGAGCGCAAGAAATCAA
AGAGTTTTAAAGAAGGAGAAAGCTATCCTTCTTGGCTCATAACCGAGGCTCCTGGGAGTATAGCCGCCGTGAGGAGGGAG
CAAGTGGCTGCACAACAAGCCCTAAGGAAACTGAAGATTGCTCATTACGGCAGATCTAAATCAACGCTAACTAATTTTAC
CTCCTCCAAAGTTGTCCCTCTTGTTCACCCTAGCCCTCATCCTCATCCTCAGAGGTGCAGCTTCATCACCCCTACTTCTG
ATCCTATTTACGTTGCCTACCATGATGAAGAATGGGGAGTCCCTGTCCATGATGACAAGACGTTGTTCGAACTGCTAACC
CTAAGTGGCGCGCAAGTAGGCTCCGATTGGACTTCAACCTTGAGAAAACGCCATGACTTCAGGAAAGCATTTATGGAATT
TGAAGCGGAAGCGGTTGCAAAAATTAGCGAGAAAGAGATGAATGAAATAAGCACCGAATACAAGATAGAGATGAGCAAAG
TGAGAGGCATTGTGGAGAACGCAACAAAGATCCTAGAGATCAAGAAAAACTTCGGGTCACTAGAGAAGTACATTTGGGGT
TTTGTGAACCACAAACCCATCTCCACGAACTACAAGTTTGGCCACAAGATTCCGGTCAAGACATCCAAGTCGGAGAGCAT
AAGCAAAGACATGGTGCGTCGAGGCTTCAGGTACGTGGGCCCCACTGTGGTTCACTCCTTCATGCAAGCCGCTGGTCTAA
CCAATGACCACTTGCTCACTTGTTACCGTCACATTCCTTGCACTCTCTTCAGTACCAATCCCTAA