Details for Kale Locus Bo5g133170

Position : C5 ( 5`- 41527967 .. 41530018 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133170

Protein [Map View]
MHKLSRSNRDKLQQFVAITGASDKNALQALKASDWQLEAAFDVFYSQPQPRSNGDMRRLEELYNRYKDPYSDMILAEGIS
VLCSDLQVEPQDIVTLVLSWHMNAATACEFSKEEFFGGLQALGVDSIGKLQEKLSFMRSELKDEQKFHEIYNFAFGWAKE
KGQKSLALDTAIGMWQLLFAEREWPLVNHWCDFLQDRHNKAISKDTWAQLLEFARTVDPALSNYDAEGAWPYLIDEFVEY
LYDKSVVEK*

DNA
ATGCATAAGTTGAGTAGAAGCAACCGCGACAAACTTCAGCAGTTCGTGGCTATCACTGGAGCTAGTGATAAGAATGCTCT
TCAGGCTCTCAAAGCCAGCGATTGGCAGCTCGAAGCAGCTTTTGATGTGTTTTACAGCCAGCCCCAGCCAAGAAGCAATG
GTGATATGAGACGCTTGGAGGAGCTCTACAATAGATATAAAGACCCATATTCTGATATGATTCTGGCCGAAGGTATCTCG
GTTCTGTGTAGTGATCTTCAGGTGGAACCCCAAGACATTGTCACGCTGGTTCTGTCGTGGCATATGAATGCTGCAACAGC
GTGTGAATTTTCCAAGGAAGAATTTTTTGGTGGATTACAGGCATTAGGCGTAGATTCCATTGGGAAGTTGCAAGAAAAGC
TGTCATTTATGCGTTCTGAGCTTAAAGATGAACAAAAGTTCCATGAAATATACAACTTTGCTTTTGGGTGGGCGAAAGAG
AAGGGACAGAAGTCTCTTGCTTTAGATACAGCTATTGGTATGTGGCAGCTGCTTTTTGCAGAAAGAGAGTGGCCATTAGT
AAACCACTGGTGTGATTTCTTACAGGATCGTCACAACAAGGCCATATCTAAAGACACGTGGGCACAGCTCCTGGAGTTTG
CAAGGACGGTGGACCCGGCGCTGTCGAACTACGATGCAGAAGGAGCATGGCCTTACCTCATCGATGAGTTCGTTGAGTAC
CTGTATGACAAGAGCGTTGTTGAGAAGTAA