Details for Kale Locus Bo5g133160

Position : C5 ( 5`- 41522789 .. 41523922 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133160

Protein [Map View]
MSSSSSPGIRNLFRTMSSSSNSDTDDDDLTRVLSVRRPRSNSIDLNRRRAEKVRPVSTREKKEDESESKSTPGEDKVGDI
VRFGRNSYFVVDIFEKEIMELGDKVDLNFKRFNKFEAVDGCCPWDHHFSNYRCCYSSCCCVCSISNVEREWGKLQRELEK
RDGSSNGVSFFVRTYNERKELMRVAVTDQSHSLFFFDIKFPTEYPHQAPSLFYHSYGLPLSNYETHTLLKAKIHYNILDV
FLLIEEIVMNNTNKSCHQMLDMLKRPLNGFEDFVKGHFRKKGAFILKNMIEEMDLAKERDRNMFFKTYVAFEDNKTYGEH
LLNSDLKEELEGYKEKECSSDHYYSSSSSYFQPITSRFDDIQKTPRYKNFLNKIFLL*

DNA
ATGAGCAGTAGTAGCAGTCCTGGTATTCGAAATTTATTCAGAACCATGAGCAGTAGTAGTAACAGCGACACTGATGATGA
TGATCTAACAAGAGTTTTATCTGTACGACGCCCTAGGTCAAATTCTATTGACCTAAATAGGAGGCGTGCTGAGAAAGTTA
GACCAGTTTCTACTAGAGAAAAGAAAGAAGATGAATCAGAGTCTAAATCGACACCAGGAGAAGATAAAGTTGGTGACATC
GTTCGCTTCGGACGAAACAGCTACTTTGTGGTTGACATCTTCGAGAAGGAGATCATGGAGTTGGGAGATAAGGTGGATTT
AAACTTCAAGAGATTCAACAAGTTCGAAGCTGTTGATGGATGTTGTCCATGGGATCATCACTTCAGCAACTACAGGTGTT
GTTACTCATCTTGCTGCTGCGTATGTTCAATCAGTAACGTTGAGAGAGAGTGGGGGAAGCTGCAGAGAGAGTTAGAGAAG
AGAGATGGTTCTTCCAATGGAGTCAGCTTCTTTGTTAGAACTTACAACGAAAGAAAAGAGCTGATGAGAGTTGCTGTAAC
CGATCAGAGTCACAGCTTGTTCTTCTTCGACATTAAGTTCCCTACAGAGTATCCACACCAAGCGCCGAGTCTCTTCTACC
ATTCCTATGGCCTTCCTTTGAGTAACTATGAGACACATACGTTACTAAAGGCCAAAATTCATTACAACATATTAGATGTG
TTTCTACTCATTGAAGAGATTGTGATGAACAACACCAACAAGTCATGTCATCAGATGCTAGATATGCTGAAGCGTCCTCT
CAATGGGTTTGAGGATTTTGTGAAAGGTCATTTTAGGAAGAAGGGTGCTTTTATTCTGAAGAACATGATTGAAGAGATGG
ATTTGGCAAAGGAGAGAGATAGAAACATGTTCTTCAAGACTTATGTTGCCTTTGAAGACAATAAAACTTACGGTGAGCAT
CTTCTCAACAGTGATCTTAAAGAAGAGCTGGAGGGGTACAAAGAGAAAGAGTGTTCTAGTGATCACTACTACTCTTCTTC
ATCTTCCTACTTCCAACCCATTACTAGCAGGTTTGATGATATTCAGAAGACACCCAGATACAAAAACTTCTTGAACAAGA
TCTTTCTCTTGTAG