Details for Kale Locus Bo5g133150

Position : C5 ( 5`- 41517876 .. 41522197 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133150

Protein [Map View]
MDSPFKPDVLKGKVALITGGGSGIGFEISSQFGKHGASIAIMGRRKQVLDAAVSDLRSLGIPAVGFEGDVRKPEDARRVV
ESTFNHFGKVDILVNAAAGNFLAAAEDLSTNGFRTVLDIDAVGTFNMCREALKYLKKGGPGRDSSSGGGSILNISATLHY
TASWYQIHVSAAKAAVDAATRNLALEWGTDYEIRVNGIAPGPIGGTPGMSKLGPDEIENKAGDYIPLYKLGEKWDIAMAA
LYLSCDSGKYVNGLTMVVDNGQWLSRPRNLPKEAVKELSRVVEKRREMVLRFCWLKTQYCNDMRPDYGFERQTEPNILPS
LVPEFSSVRQKIVSHTLSHCPISRDPLLSSKLNMSSAAASPALSLLKSTGGVASSAATRARATLLPITSKSKSISTRPLG
FSAVLDSRFTVHVASKVQSFRGKGTRGVVSMAKKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKY
LIDNGAKVILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVGSLPEGGVLLLENVRFYQEEEKND
PEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVSSPKRPFAAIVGGSKVSSKIGVIE
SLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPTDVVVADKFAPDANSKVVSASGI
EDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAG
VMSHISTGGGASLELLEGKVLPGVIALDEA*

DNA
ATGGACTCTCCGTTCAAGCCCGATGTACTCAAAGGCAAGGTTGCTCTCATCACCGGCGGCGGATCCGGCATCGGGTTCGA
GATCTCCTCTCAGTTCGGCAAACATGGAGCTTCCATCGCCATCATGGGTCGCCGCAAACAAGTCCTCGACGCCGCCGTCT
CTGATCTCCGATCTCTCGGGATTCCGGCTGTTGGGTTTGAAGGTGATGTTCGTAAGCCAGAGGATGCGAGAAGAGTCGTT
GAATCAACTTTTAACCATTTCGGTAAGGTTGATATCCTCGTCAACGCCGCCGCTGGAAACTTCCTTGCTGCGGCTGAGGA
TCTGTCCACCAATGGGTTCCGAACAGTTTTGGACATTGATGCTGTAGGAACATTCAACATGTGCCGTGAAGCACTCAAGT
ATCTTAAGAAAGGAGGGCCTGGTAGAGACTCATCAAGCGGCGGAGGTTCGATTCTCAACATTAGCGCTACTCTGCACTAC
ACTGCTTCTTGGTACCAAATCCATGTCTCTGCAGCCAAGGCTGCAGTTGATGCTGCGACAAGGAACTTGGCATTGGAGTG
GGGAACCGACTACGAGATCAGAGTGAACGGGATCGCACCAGGCCCCATCGGAGGTACACCTGGAATGAGTAAACTTGGAC
CAGACGAGATTGAGAACAAAGCCGGAGATTATATACCTCTCTACAAACTTGGGGAGAAGTGGGATATCGCCATGGCTGCC
CTTTACCTCAGCTGTGATTCTGGGAAGTATGTGAATGGACTGACAATGGTGGTAGATAATGGACAGTGGCTTAGCAGACC
TCGAAATCTGCCCAAAGAAGCTGTCAAGGAACTCTCTCGTGTTGTGGAGAAGAGGCGAGAAATGGTATTAAGATTCTGTT
GGTTGAAGACACAGTACTGTAATGATATGAGACCAGATTACGGTTTTGAACGCCAAACCGAACCGAACATTTTGCCTAGT
TTGGTTCCTGAGTTCAGTTCAGTTAGACAGAAGATTGTGAGTCACACTCTCTCTCATTGTCCCATATCTCGTGATCCTCT
TCTCTCCTCTAAACTCAACATGTCATCCGCCGCCGCAAGTCCAGCTCTTTCACTCCTCAAGTCAACCGGCGGCGTTGCTT
CATCCGCCGCAACTCGAGCACGCGCCACCCTTCTACCCATCACCTCCAAATCCAAATCCATCTCCACGCGTCCTCTCGGC
TTCTCCGCCGTCCTCGACTCCCGTTTCACCGTCCATGTCGCCTCAAAGGTTCAGTCTTTCCGCGGCAAAGGCACCAGAGG
AGTAGTCTCCATGGCCAAGAAGAGCGTCGGAGACTTGACCTCTGCTGATTTGAAAGGGAAGAAGGTTTTCGTGAGAGCTG
ATCTCAATGTACCTCTCGATGACAATCAGACAATCACTGACGATACGAGAATCCGTGCCGCCATTCCCACAATCAAGTAC
TTGATCGACAATGGCGCTAAAGTCATCCTCTCCACTCATCTGGGAAGGCCAAAGGGAGTCACACCAAAGTTCAGTTTAGC
TCCCCTTGTCCCTAGACTCTCTGAGCTTCTTGGTATTGAGGTCAAGAAAGCTGACGACTGTATTGGTCCTGAAGTTGAGA
GCTTGGTGGGTTCTCTTCCTGAAGGTGGAGTTTTGCTTCTTGAGAACGTCAGGTTTTACCAGGAGGAAGAGAAGAACGAT
CCAGAGTTCGCTAAGAAGCTTGCTTCGCTTGCTGATCTTTATGTCAATGATGCTTTTGGAACTGCTCACAGAGCTCATGC
TTCCACTGAGGGTGTCACTAAGTTCTTGAAACCTTCCGTTGCTGGTTTCCTTCTGCAAAAGGAGCTTGATTACCTTGTGG
GAGCGGTTTCGAGCCCAAAGAGACCATTTGCAGCCATAGTGGGTGGTTCCAAGGTCTCGTCCAAGATTGGAGTTATTGAA
TCGCTTCTTGAGAAGTGTGATATCCTTCTTCTTGGTGGTGGGATGATCTTTACATTCTACAAGGCGCAAGGTCTTTCTGT
TGGCTCGTCCCTTGTTGAAGAAGACAAACTCGAACTGGCTACATCTCTCCTTGCCAAAGCTAAGGCCAAAGGCGTCTCTC
TTTTGTTGCCGACCGATGTTGTGGTTGCTGACAAGTTCGCTCCTGATGCAAACAGCAAGGTTGTGTCTGCATCAGGCATT
GAGGACGGATGGATGGGACTGGACATCGGTCCAGACTCGATAAAAACATTCAACGAAGCTCTGGACACAACACAGACAGT
CATTTGGAATGGACCTATGGGAGTTTTCGAGATGGAGAAGTTTGCTGCTGGAACAGAGGCCATTGCGAATAAACTAGCAG
AGCTAAGTGAAAAAGGAGTGACAACGATAATAGGAGGAGGAGACTCAGTGGCTGCAGTGGAGAAAGTAGGAGTTGCAGGA
GTCATGAGTCACATCTCCACTGGTGGTGGAGCCAGCTTGGAGCTCTTGGAAGGCAAAGTACTTCCCGGTGTGATCGCTCT
TGATGAAGCTTAA