Details for Kale Locus Bo5g133130

Position : C5 ( 5`- 41503066 .. 41511261 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133130

Protein [Map View]
MASRGGKSIPDSAMSSKGAKSRPDSDSKPKRHKTLEAPKEPRRPKTHWDHVIEEMIWLSKDFESERKWKLAQAKKVALRA
SKGMVDQASREERKLKEEEQRLRKVALNISKDVKKFWIKVEKLVLYKHQLVRNEKKKKAMDKQLEFLLGQTERYSTMLAE
NLVEPYKHGHNKSPKPILAIESKSDEERAEETPSELNASAGLESETLDVDEDYDLNSEDASEDDEDTIEEDEKHFTKQER
QEELESLQNEVDLPVEELLRRYTASRVSGETSPERDENEANLASVGEDHIEADKNNLTASEETEGSPSVRRSNDSFDHLA
VSETHTHDHKPGPKTASVKSGKEDQTYDFNDEQEDVDFVAATGEEKDDETTLSVEEELAKADSVDPEDEIALLQKESEMS
IEELLARYKEDFGGKDLSEDDSSDIRQQADSDDENVESAECKPALQPCSEKDEGTSNEIKEDDGKDNSDKIADAAAAARS
AQPTGFTYSTTKVRTKLPFLLKHSLREYQHIGLDWLVTMYEKRLNGILADEMGLGKTIMTIALLAHLACDKGIWGPHLIV
VPTSVMLNWETEFLKWCPAFKILTYFGSAKERKLKRQGWMKLNSFHVCITTYRLVIQDSKMFKRKKWKYLILDEAHLIKN
WKSQRWQTLLNFNSKRRILLTGTPLQNDLMELWSLMHFLMPHVFQSHQEFKDWFCNPIAGMVEGQDKINREVIDRLHNVL
RPFLLRRLKRDVEKQLPQKHEHVIFCRLSKRQRNLYEDFIASTETQATLNSGSFFGMISIIMQLRKVCNHPDLFEGRPIV
SSFDMPGIDVQLSSRICSLLLKSPFSRVDLEDLGFLFTHHDFSMTSWEGDEIKTISTPSDLIKHRVDLKDNPEEVPLSLV
NRKNLQGTNIFEEIRKAVFEERVKESKDRAAAIAWWNSLRCRRKPTYSTSLRTLLTIKGPLDDIHHLKANRPSYMYSSML
ADIVLSPIERFQKVIELVEAFTFAIPAARAPSPACWCSKSDSPVFLSPSYKEKVTDLLSPLLSPIRPAIVRRQVYFPDRR
LIQFDCGKLQELAMLLRKLKFGGHRALIFTQMTKMLDILEAFINLYGYTYMRLDGSTPPEERQTLMQRFNTNPKIFLFIL
STRSGGVGINLVGADTVIFYDSDWNPAMDQQAQDRCHRIGQTREVHIYRLISESTIEENILKKANQKRALDNLVIQNGEY
NTEFFKKLDPMELFSGHKTLTRKDEEEKSKNCEAELPLSNADVEAALKHAEDEADYMALKRVEEEEAVENQEFTEEPIER
PEDDEIVNEDDIKSDEPADQGVAAAGSAKEEVSLVPIDNRDERDDIITLSQEEDNDVPDDVKQMAAAAAAAGQAISSFEN
QLRPIDRYAIRFLEVWDPIIVEAAIENEAGFEEKEWELDHIEKYKEEMEAEIDDGEEPLVYEKWDADFATEAYRQQVEVL
AQHQLMEDLENEAREREAAEEAERRLALNESAHVLKPKKKKKVKKAKYKSLKKGSLGSESKQAKPVVKVEASSDEDNEEC
GYVSSSDSDMVSPRLQKRMKGKKRELVFDSDEEKNSKKKAKKHKKPLSHSDIKCKTPHDELVPSKPSDSMAVDNELKPAN
RGKTLGKKFIISMPIKRVLMIKPEKLKKGNLWSRDCVPSPDSWLPQEDAVLCAMVHEYGSNWSLVSETLYGMAAGGAYRG
RHRHPAYCCERYRELMQRHVLSASDSVVNEKNLNAGSGKALLKVTEENMRALLNVAAEQPDTEMLLQKHFTCLLSSIWRT
STRSTNNQKLSLNSPIFNRQVMGSANHTQELARKPFQGMKITSLSSKLVEFALQDSSTSQPLDTASRPRLQEPINKVGLD
LTLEFPHGNDDSSTHFPPIIKLTIDGSDSFNYVNDPPGEDKLKVSRIAAEDRYRNAANACIEDSFGWASNTFPAYDPKSR
SGVKAQSLGKHKLSASDTPKSSKSKQRKLSAAEQSEVSWVRRNDPNLKFDFTPADREEVEEDKEVSEEIEMIGCSHWYDP
LLTSGLDDCSLASEPSGIE*

DNA
ATGGCGTCTAGAGGTGGAAAGTCGATACCCGATTCAGCAATGTCGTCCAAAGGTGCCAAATCTAGACCCGATAGCGACTC
CAAACCTAAGCGACACAAGACGCTGGAAGCTCCTAAAGAGCCGCGACGACCTAAGACTCACTGGGACCATGTTATAGAGG
AGATGATTTGGCTCTCAAAGGACTTTGAGTCTGAGAGGAAATGGAAGCTAGCTCAGGCAAAGAAAGTTGCTCTGAGGGCC
AGCAAAGGCATGGTAGATCAAGCTTCGAGGGAAGAAAGGAAGCTTAAGGAAGAAGAACAGAGACTGAGGAAAGTAGCCCT
TAATATCTCTAAAGACGTTAAAAAGTTTTGGATCAAAGTTGAGAAGCTGGTGCTCTACAAGCATCAGCTAGTACGCAATG
AGAAAAAGAAGAAGGCTATGGACAAGCAACTTGAGTTTCTGTTAGGCCAGACTGAGAGGTACTCAACTATGTTGGCAGAA
AATTTAGTGGAGCCTTATAAACATGGCCACAACAAATCTCCTAAACCTATTCTGGCTATCGAATCAAAAAGTGATGAAGA
AAGGGCAGAAGAGACACCTTCGGAGTTGAATGCTTCTGCAGGTCTTGAATCAGAAACTCTTGATGTCGATGAGGATTATG
ATCTCAATTCCGAGGATGCGTCAGAAGATGATGAAGATACTATTGAGGAGGATGAAAAGCACTTCACCAAACAGGAAAGG
CAAGAAGAGTTGGAATCTTTGCAAAATGAAGTGGATCTACCAGTTGAGGAGCTACTCAGACGTTATACTGCTAGTAGAGT
TAGCGGAGAAACCAGCCCAGAAAGAGATGAAAATGAAGCTAATCTGGCATCAGTAGGTGAAGATCATATAGAGGCTGACA
AAAACAATCTTACAGCTTCTGAAGAAACTGAAGGGAGCCCAAGTGTTCGTCGTTCTAATGATAGCTTTGATCATTTAGCA
GTATCCGAGACCCATACACATGATCACAAGCCAGGCCCAAAAACTGCCTCTGTGAAGTCCGGAAAGGAAGATCAGACCTA
TGATTTCAACGATGAACAGGAGGATGTTGATTTTGTTGCTGCCACTGGTGAGGAAAAGGATGATGAGACGACACTGTCCG
TTGAAGAGGAACTGGCAAAAGCAGATAGTGTGGACCCTGAGGACGAGATTGCTCTGCTACAGAAGGAGAGTGAAATGTCT
ATTGAAGAATTGCTTGCAAGGTATAAGGAGGATTTCGGTGGCAAGGATTTATCTGAAGATGATTCGTCAGATATCAGGCA
GCAAGCTGATTCAGATGACGAAAATGTTGAATCAGCCGAATGTAAGCCAGCTTTACAGCCTTGCTCAGAAAAAGATGAAG
GCACATCCAATGAAATAAAAGAAGATGATGGTAAAGATAACAGTGACAAAATTGCTGATGCAGCAGCAGCAGCAAGATCT
GCACAGCCAACTGGATTTACATACTCTACAACAAAAGTTAGAACGAAATTGCCGTTTCTTCTCAAGCATTCTTTGCGTGA
GTACCAACACATTGGCTTAGACTGGCTTGTCACGATGTATGAGAAAAGGTTGAATGGGATTTTAGCTGATGAAATGGGTC
TTGGAAAGACGATCATGACCATCGCTCTTCTCGCACATCTTGCTTGTGATAAGGGGATATGGGGTCCCCATCTGATCGTG
GTTCCGACAAGTGTGATGCTGAATTGGGAAACTGAATTTCTTAAATGGTGTCCTGCATTCAAAATCCTCACCTACTTTGG
GAGTGCAAAGGAGCGAAAACTCAAGAGACAAGGGTGGATGAAGCTGAACTCCTTTCATGTATGCATAACAACCTATAGGC
TAGTTATCCAGGACAGTAAAATGTTCAAGCGCAAGAAGTGGAAGTACTTGATTCTTGATGAAGCCCATTTAATTAAGAAC
TGGAAGTCTCAGAGATGGCAAACTCTGTTGAACTTCAATTCTAAACGCAGAATTTTGTTGACTGGTACACCGCTGCAAAA
TGATCTTATGGAATTGTGGTCACTGATGCATTTTCTGATGCCACATGTCTTTCAGTCTCACCAGGAGTTCAAAGATTGGT
TCTGTAACCCGATAGCAGGGATGGTGGAGGGCCAAGATAAAATCAATAGAGAAGTTATTGATCGCTTGCATAATGTCCTC
CGTCCTTTCCTTCTACGACGCCTAAAAAGAGATGTAGAAAAACAACTTCCTCAGAAACATGAGCATGTTATTTTCTGCAG
ATTGTCTAAGAGGCAGCGCAACTTGTATGAGGACTTCATAGCAAGCACAGAAACACAGGCTACACTTAACAGCGGAAGCT
TTTTTGGGATGATAAGTATCATAATGCAACTGCGGAAAGTTTGTAATCATCCTGATCTCTTTGAGGGTCGGCCTATTGTA
AGTTCTTTTGATATGCCTGGCATTGATGTGCAGTTGAGTTCGAGAATCTGCTCTCTTCTTTTGAAAAGTCCATTTTCCAG
AGTCGATCTTGAAGATCTGGGATTCTTATTCACCCATCATGATTTTTCTATGACTTCTTGGGAAGGGGATGAGATCAAGA
CTATTTCAACGCCCTCCGATTTGATCAAGCATCGGGTGGACTTGAAGGATAATCCAGAAGAAGTTCCTCTGAGTTTAGTA
AACCGCAAAAATCTGCAAGGGACAAATATTTTTGAAGAAATTCGTAAGGCTGTCTTTGAGGAAAGGGTTAAAGAATCCAA
GGATCGGGCAGCAGCCATTGCATGGTGGAATTCTTTGAGATGCCGGAGAAAGCCTACTTACTCTACATCTTTAAGAACTC
TTTTAACCATTAAGGGTCCTCTTGATGATATACACCATCTCAAAGCTAATCGTCCATCTTACATGTACTCCTCAATGCTC
GCTGACATAGTTCTTTCACCGATCGAGCGTTTCCAGAAGGTAATTGAGCTAGTCGAAGCTTTCACGTTTGCGATTCCTGC
TGCAAGAGCGCCTTCACCTGCTTGCTGGTGCAGCAAAAGTGACTCTCCTGTTTTTCTTAGTCCATCGTACAAGGAGAAAG
TTACAGATCTATTGTCACCTCTTCTGTCTCCGATTAGGCCTGCGATTGTTAGGAGACAAGTATATTTTCCAGATAGGCGG
CTGATACAGTTTGACTGTGGTAAGCTGCAGGAGCTTGCTATGTTACTGAGAAAATTAAAATTTGGGGGTCACAGAGCGTT
GATATTCACGCAAATGACCAAGATGCTTGACATCTTGGAGGCTTTCATTAATTTATACGGTTATACCTACATGCGTCTTG
ACGGTTCTACTCCACCAGAAGAGAGGCAGACATTAATGCAGCGGTTTAACACAAATCCCAAGATTTTTCTCTTCATCTTG
TCAACCCGAAGTGGGGGTGTAGGCATAAACCTTGTTGGTGCAGACACAGTTATCTTCTATGACAGTGACTGGAATCCCGC
AATGGATCAACAAGCTCAAGATCGCTGCCACAGGATTGGTCAGACACGGGAAGTGCATATTTATCGGTTGATAAGTGAGA
GCACCATTGAAGAGAATATCTTGAAGAAGGCAAACCAGAAGCGTGCGCTTGATAACCTAGTTATTCAGAATGGTGAATAT
AACACCGAGTTTTTCAAGAAGCTCGACCCAATGGAATTGTTCTCTGGGCATAAAACTCTGACTAGGAAGGATGAAGAGGA
AAAGAGCAAGAATTGTGAGGCGGAGCTCCCTCTGTCAAACGCAGATGTCGAGGCTGCTTTAAAACATGCAGAAGATGAAG
CAGATTATATGGCTCTCAAAAGAGTAGAAGAAGAAGAAGCTGTGGAGAATCAAGAGTTTACAGAAGAACCTATAGAGAGA
CCAGAAGACGATGAGATAGTAAATGAGGATGACATTAAGTCTGATGAGCCTGCTGATCAAGGTGTAGCTGCAGCTGGGTC
GGCTAAAGAAGAAGTTTCATTGGTACCTATTGATAACAGGGATGAGAGAGATGACATCATTACTTTAAGCCAAGAAGAAG
ATAATGATGTACCAGATGATGTCAAGCAAATGGCTGCAGCAGCCGCTGCTGCTGGACAAGCTATCTCATCTTTTGAGAAC
CAGCTGCGTCCTATTGATAGATATGCGATTAGATTTTTAGAGGTTTGGGACCCCATCATTGTTGAGGCTGCTATTGAAAA
TGAAGCGGGATTTGAAGAGAAAGAATGGGAACTTGACCACATTGAGAAGTACAAGGAGGAAATGGAAGCTGAAATTGATG
ATGGTGAAGAGCCTCTTGTTTATGAGAAATGGGACGCTGATTTTGCAACCGAGGCATACAGGCAGCAAGTTGAAGTTTTA
GCTCAGCACCAGTTGATGGAAGATCTAGAAAATGAAGCTAGAGAGAGGGAAGCTGCAGAAGAGGCTGAAAGGCGTTTGGC
ACTGAACGAAAGTGCCCATGTACTTAAACCTAAGAAGAAGAAAAAGGTGAAGAAAGCCAAATATAAATCCCTGAAAAAAG
GATCACTCGGGTCCGAGTCAAAACAAGCGAAGCCAGTGGTGAAAGTTGAAGCTTCGAGTGATGAAGACAATGAAGAATGC
GGATATGTGAGTAGCAGTGACTCAGACATGGTCTCACCGCGTTTGCAGAAACGTATGAAAGGCAAGAAAAGAGAATTAGT
CTTCGACAGTGATGAAGAGAAGAACTCGAAGAAGAAAGCAAAGAAGCATAAGAAGCCTCTTTCACATTCAGATATCAAAT
GCAAGACTCCGCATGATGAACTGGTTCCATCAAAGCCGTCTGACAGTATGGCTGTTGATAATGAATTGAAACCGGCAAAC
AGGGGTAAAACCCTAGGGAAAAAGTTCATCATTTCTATGCCAATAAAGCGTGTTCTTATGATCAAGCCAGAGAAATTGAA
GAAAGGAAATCTCTGGTCTAGAGACTGTGTTCCCTCGCCTGATTCTTGGTTGCCTCAGGAAGATGCTGTATTGTGTGCTA
TGGTTCATGAATATGGGTCTAACTGGAGTTTAGTTAGCGAGACTCTTTACGGAATGGCTGCTGGTGGAGCTTACAGAGGA
AGGCATCGCCATCCTGCATATTGTTGTGAGAGATATAGGGAGCTTATGCAGCGACATGTTTTGTCTGCTTCCGACAGTGT
AGTGAACGAAAAGAACCTCAACGCTGGTTCTGGGAAGGCTCTCCTTAAAGTAACTGAGGAAAATATGCGGGCACTCCTAA
ATGTTGCAGCTGAGCAGCCAGATACGGAGATGCTCCTTCAAAAACACTTTACTTGCTTGCTGTCTTCAATCTGGAGGACG
TCAACACGCTCTACAAACAATCAAAAGCTCTCCTTAAATAGTCCCATATTCAACAGACAGGTTATGGGTTCTGCGAATCA
CACTCAAGAATTAGCGAGAAAACCTTTTCAGGGGATGAAGATCACCAGCTTAAGTAGCAAGTTGGTAGAATTCGCTCTCC
AGGACTCAAGCACGAGCCAGCCACTCGATACTGCTTCTCGTCCTAGATTACAGGAACCTATCAATAAAGTGGGATTAGAC
CTAACCTTGGAGTTCCCACATGGCAATGATGATTCCTCGACTCATTTCCCACCCATCATAAAGCTAACTATTGATGGATC
AGATTCATTCAATTATGTGAATGACCCTCCAGGGGAAGATAAGCTCAAAGTATCTCGGATTGCTGCAGAGGACCGTTACA
GGAATGCTGCAAATGCGTGTATTGAAGATTCGTTTGGATGGGCTTCAAACACGTTCCCCGCATATGATCCGAAGTCGAGA
AGTGGAGTGAAAGCACAGTCCCTGGGGAAGCACAAGCTATCCGCCTCAGACACGCCCAAGTCCTCAAAGAGCAAACAGCG
AAAACTCTCAGCAGCAGAACAATCGGAAGTGTCATGGGTGAGGCGAAATGACCCTAATCTCAAGTTCGATTTTACACCTG
CCGATAGAGAAGAGGTGGAAGAGGATAAGGAGGTTTCAGAAGAGATAGAGATGATAGGTTGTTCACATTGGTATGATCCT
TTGTTAACCTCAGGCCTTGATGATTGCTCATTAGCGTCTGAACCCTCAGGAATAGAGTAG