Details for Kale Locus Bo5g133110

Position : C5 ( 5`- 41480828 .. 41482674 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133110

Protein [Map View]
MVCDSQLWPSVATYDWVRKLAITLSAIAVDTLFFDPWTFGSVGSSSSLLSSFHPSESALNQINAVYLKIGSCIFEATKIP
CQSNEFVHELLRGVGQHFDRFIKDLKIVNDNYLYARVSKVIEDKSKLSEEHIPMLTDILGDEDKAKEILGAEKALFRALK
TRGNTPKYGLIFHSSFIGRASAKNKGRIARYLANKCSVASRIDCFADSSTTAFGEKLREQVEERLEFYDKGVAPRKNVDV
MKEVLESLEKKDEGEAIAVEASEKNKKKDKRKTEEKDEGEDGEKSTKKKKSKTVEEELTSHRRKRRRKLSHKVKNIPRQV
SVM*

DNA
ATGGTATGCGATAGCCAACTATGGCCTTCAGTAGCAACATATGATTGGGTGCGGAAGTTAGCTATAACACTCTCAGCAAT
AGCAGTAGACACTCTGTTTTTCGATCCCTGGACATTCGGTTCGGTCGGGTCGTCCAGCTCACTGCTTTCCAGTTTCCACC
CATCTGAGTCTGCTCTCAACCAAATCAACGCCGTGTATCTGAAGATCGGTTCTTGCATCTTTGAAGCCACGAAGATTCCT
TGCCAGAGCAATGAGTTCGTTCATGAGCTTCTTAGAGGTGTGGGCCAGCATTTTGATAGGTTCATCAAAGACCTAAAGAT
AGTCAACGACAACTACCTTTACGCCCGAGTTTCAAAGGTTATTGAAGACAAGTCAAAGTTGTCTGAAGAGCACATCCCTA
TGCTTACTGATATCCTTGGAGATGAAGATAAGGCTAAAGAGATTCTTGGTGCTGAGAAAGCACTTTTCAGGGCGTTGAAG
ACACGTGGAAACACACCCAAGTATGGTCTGATATTCCACTCTTCATTCATTGGCCGTGCATCTGCTAAAAACAAGGGACG
TATTGCTCGTTACCTAGCAAACAAGTGCTCGGTTGCTTCCCGGATTGATTGTTTCGCTGATAGCAGCACTACAGCTTTTG
GTGAGAAACTTAGGGAACAAGTGGAGGAGCGACTAGAGTTTTATGACAAAGGTGTTGCCCCACGTAAGAATGTGGATGTA
ATGAAAGAAGTGCTGGAAAGTCTTGAGAAGAAAGATGAGGGAGAAGCAATAGCAGTGGAGGCCTCAGAGAAGAACAAGAA
GAAAGATAAGAGAAAGACAGAGGAAAAGGATGAGGGAGAAGATGGGGAGAAATCAACGAAGAAGAAGAAAAGCAAAACAG
TAGAAGAGGAATTGACAAGTCACAGAAGAAAAAGAAGAAGAAAACTAAGTCACAAGGTGAAGAATATACCAAGACAGGTT
TCCGTAATGTAG