Details for Kale Locus Bo5g133090

Position : C5 ( 5`- 41475418 .. 41475870 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133090

Protein [Map View]
MEESSSIIAKLLLLTTLVTILVISRANEELMMQLCHNSDNLTLCLRSLRADPTAPKGDQVELARIILRCVNSHLITLTNN
TSALAWKHRRSPKAASALKQCGLGYATAKRGVGKVDAQLIAGDYDKAAYDVSMTVEAPPVSCRACGDTEF*

DNA
ATGGAGGAGTCTTCTTCTATTATAGCAAAGCTTCTTCTCCTCACCACACTTGTTACCATATTGGTTATCTCCAGAGCTAA
CGAAGAGCTAATGATGCAACTATGCCACAACTCCGACAACCTCACCTTGTGTCTTCGCTCTCTGAGAGCAGACCCAACTG
CTCCAAAAGGCGACCAAGTCGAACTGGCTCGCATCATCCTCAGATGCGTCAACTCTCACCTCATCACCCTCACCAACAAC
ACTTCCGCTTTGGCCTGGAAGCACCGCCGGAGTCCCAAGGCTGCATCCGCGTTGAAACAGTGTGGTTTGGGTTACGCGAC
GGCAAAGCGTGGCGTGGGAAAGGTAGACGCTCAGTTAATAGCAGGAGATTACGACAAGGCTGCGTATGACGTCAGCATGA
CGGTGGAGGCTCCTCCGGTCTCGTGCCGTGCCTGTGGTGACACTGAATTTTAA