Details for Kale Locus Bo5g133080

Position : C5 ( 5`- 41468395 .. 41469427 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133080

Protein [Map View]
MASSLPQFYADFTFSGNTSSQFHGSSSCPDVSALSNYYDDGYLPFNASSIRESTFYPQVFGTSDAPMQEYNYYYQKMGVN
NATQYFHGGDQEYYGFSPEIKPFGEQSWGSSEGGIQAEQTTKVGRYSVEERKERIMRYLKKKNQRNFNKTIKYVCRKTLA
DRRVRVRGRFARNNDTCEQQSHMSKTHNNNSEKEEDIFSGSDDYLIQQMENDDGWLNEAMSNMISFPCELDAPGDDHNPS
TWSF*

DNA
ATGGCATCATCTCTTCCTCAGTTCTACGCCGATTTCACATTTTCCGGCAACACTTCTTCACAGTTTCACGGCTCTTCTTC
ATGTCCTGACGTCTCAGCTCTATCCAATTACTATGACGACGGTTACCTCCCCTTCAACGCATCTTCTATCCGAGAATCCA
CATTTTATCCCCAAGTTTTTGGAACTTCTGACGCTCCTATGCAGGAGTACAACTATTATTACCAGAAAATGGGTGTGAAC
AATGCCACACAATATTTTCATGGTGGTGATCAAGAATACTACGGCTTTTCACCAGAGATCAAGCCCTTTGGAGAGCAATC
TTGGGGATCTAGTGAAGGAGGCATACAAGCTGAGCAGACCACAAAAGTGGGACGCTATTCGGTTGAAGAACGTAAAGAGA
GAATCATGAGGTACTTGAAAAAGAAGAACCAACGCAACTTCAATAAGACCATCAAGTATGTATGCCGTAAAACCCTAGCT
GACCGGCGTGTTCGTGTTCGAGGACGATTTGCTAGAAACAATGACACATGTGAACAACAATCTCACATGTCTAAAACTCA
CAACAACAATTCTGAAAAAGAAGAAGATATATTTTCTGGATCCGACGACTATCTAATCCAGCAGATGGAAAACGATGATG
GATGGCTTAACGAAGCAATGTCTAATATGATTTCTTTTCCTTGTGAATTGGACGCTCCTGGAGATGATCATAATCCAAGC
ACATGGAGCTTCTGA