Details for Kale Locus Bo5g133050

Position : C5 ( 5`- 41437200 .. 41440468 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133050

Protein [Map View]
MEEMMGSWDKRREEQEEEEEQVLKLPGFRFHPTDKELVGFYLSKKVLLKKSSKIDEIISQIDIYKFDPWDLPRSSDRGGE
VASAMFNLGCTDRGGELASDELNLIEHSCCGTNILRGNPAITDVAYVTYGLATDQRCVWFEGSTHTEKESYFFCKRGRKY
RNSIRPNRVTGSGFWKATGIDKPIYSDGPSKAVIGLKKTLVYYIGSAGKGSKTDWMMHEFRLPTANDTIPGGSTHRSPTP
SSLLHAEVWTLCRIFKRNASSRKYTPDSKELASWERVKPQQSNNREAAYISFGDNESSTNKINVMESKENNERNVFQLHQ
TPHPHQPIPMEYTSSTQVDNTVPHISNDNNMDDVNYENWDELRSVVEFAFGPSSY*

DNA
ATGGAGGAGATGATGGGATCGTGGGACAAAAGAAGGGAAGAACAAGAAGAAGAGGAGGAACAAGTGTTAAAGCTTCCAGG
GTTTAGGTTTCATCCGACCGATAAGGAGCTTGTAGGGTTTTATCTCTCTAAAAAAGTACTACTCAAGAAATCCAGCAAGA
TTGATGAGATCATCAGTCAAATCGATATCTATAAATTCGATCCATGGGATCTTCCTCGATCCTCCGATAGAGGAGGAGAG
GTTGCCTCAGCTATGTTCAATCTAGGATGCACCGATAGAGGAGGAGAGTTAGCCTCAGATGAGCTCAATCTAATTGAACA
TAGCTGTTGTGGGACAAACATTCTCAGAGGAAACCCTGCGATTACTGATGTGGCTTATGTCACGTACGGGCTGGCTACTG
ATCAAAGGTGTGTTTGGTTTGAAGGCTCGACGCATACGGAGAAGGAGAGCTACTTCTTCTGCAAGAGAGGAAGGAAGTAC
AGAAATAGCATAAGACCAAACCGAGTGACTGGTTCCGGTTTCTGGAAAGCCACGGGAATAGACAAACCTATCTACTCCGA
TGGCCCCAGCAAAGCCGTGATCGGTCTAAAGAAGACACTGGTTTATTACATCGGAAGCGCCGGGAAAGGAAGCAAGACAG
ATTGGATGATGCACGAGTTTCGCCTCCCCACAGCCAATGACACTATCCCTGGTGGCTCCACCCACCGTAGCCCTACTCCG
TCTTCCTTGCTACATGCTGAAGTGTGGACATTGTGTCGGATATTCAAGAGGAATGCGTCTAGTAGAAAATACACTCCGGA
CTCGAAAGAATTAGCAAGTTGGGAACGCGTGAAGCCACAACAATCTAATAATCGCGAAGCAGCTTATATCAGTTTTGGTG
ACAATGAGAGTAGTACCAACAAGATCAACGTCATGGAAAGCAAAGAGAATAATGAGAGGAACGTTTTCCAGCTTCACCAA
ACGCCTCATCCACACCAGCCCATTCCCATGGAGTACACTAGTAGCACACAAGTGGATAACACAGTTCCACATATCTCAAA
CGATAATAACATGGACGATGTAAACTACGAGAACTGGGACGAGCTTCGCTCGGTTGTGGAGTTTGCTTTTGGCCCTTCCT
CTTATTAG