Details for Kale Locus Bo5g133040

Position : C5 ( 5`- 41429156 .. 41430339 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133040

Protein [Map View]
MAVEAHHLNHLYSSNNRERMNPVEANGLVYNTQMRYNTVQATTMPFNPAMECQTSLLNPIYNVSPFDCLVQQSMKPMIHS
VESSLTFNSETNGNVGYLCPVSSSSMRKRPREESAVVNHMPSQKRCTDPLMFLGQDLSSNVQHHNFDIDRLISHHVEIMR
MEIEEKRKAQGRKIMEAIEQGLVKTLRAKDEEINHIGKLNLFLEEKVRSLCVENQIWRDMAQSNEATVNSLRSNLQQVLA
AVERNKWEEPTAADDAQSCCGSNDEGDSDERWRLAGEAKSVRTITSTMCRGCGKGEASVLLLPCRHMCLCTVCGSSVNTC
PVCKSPKNASLHVNLSS*

DNA
ATGGCCGTTGAAGCTCACCATTTAAATCATCTATATTCTTCTAATAACAGAGAAAGGATGAATCCCGTTGAAGCCAACGG
TTTAGTCTATAACACCCAGATGAGATATAACACTGTTCAAGCGACGACCATGCCGTTTAACCCCGCCATGGAATGTCAAA
CTTCTCTGTTGAATCCAATTTACAACGTCTCACCGTTTGATTGCCTGGTTCAACAGTCCATGAAACCGATGATCCATTCC
GTTGAGAGTTCCTTGACATTCAACAGCGAGACTAATGGCAACGTCGGTTATCTTTGTCCTGTTTCTTCGTCGTCTATGCG
AAAACGCCCTAGAGAAGAATCAGCAGTTGTTAATCATATGCCAAGCCAGAAACGTTGCACTGATCCTCTCATGTTCCTCG
GACAAGACTTGTCTTCTAACGTCCAACATCACAACTTCGATATCGACCGTTTGATCTCTCATCATGTTGAGATAATGAGA
ATGGAGATTGAAGAAAAGAGAAAAGCGCAAGGTAGGAAGATAATGGAAGCCATTGAACAAGGGTTGGTGAAGACACTGAG
AGCCAAAGACGAAGAGATCAATCACATAGGGAAACTAAACCTCTTTCTTGAGGAGAAGGTTAGGTCTCTCTGCGTTGAGA
ATCAGATATGGCGTGACATGGCACAGTCTAATGAAGCCACCGTGAACTCCCTACGTTCAAACTTGCAACAAGTCCTCGCA
GCTGTGGAACGTAACAAGTGGGAGGAGCCCACGGCGGCTGATGACGCGCAGTCTTGTTGTGGAAGCAACGACGAGGGTGA
TAGTGACGAGCGGTGGAGGTTAGCAGGAGAGGCTAAAAGCGTGCGTACGATAACAAGCACGATGTGTAGAGGGTGTGGGA
AAGGAGAAGCAAGTGTGTTACTGTTGCCGTGTAGACACATGTGTTTATGCACTGTGTGTGGATCTTCGGTTAACACTTGT
CCAGTCTGTAAATCTCCAAAGAATGCTAGTCTCCATGTTAATCTTTCCTCGTGA