Details for Kale Locus Bo5g133020

Position : C5 ( 5`- 41416262 .. 41417985 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133020

Protein [Map View]
MAANGLPTLGRVKLCDLLPTEGLPSDSYKLAVSTLSQSLAQYSAAIIQFPSADAALLRSGLDSARLYFHQRDSYPSTNDS
REWCKTSGYYSDPHSWQESYEYRPGLTFTEAAAASMEFPPSGLPDIFGLLGKASRLVLDAIGFYLNLRSSPFTEILDNVP
LRSNEVSSSVLSVCCYARPSFHHHHNLAEDEQLLLYSDHDHQLDKSLISFVKSDKAGLHVRDMHGQWILVDVDLGPQEAV
VYPGLALYQATAGYVSPAVYRTDFNSMQGSIEGRFSLAFKLMPKSMTNLSCSEMRAAGHGVDAQFLIPVSVDDFMQRPHS
NDELFNRQTLQSFTVPQSQDGSMKQMKKRKKSDSRLKPLPPSKRLRLEAQRVLKERVQEIADKKGIKLRFCNPKDCESNH
NTMNSPCAHIKMEIGWPQGVPFVHPHDLPNKAKIGFLETYEPGWSETHYMELSLSEAAQGNQHVT*

DNA
ATGGCAGCGAATGGTCTCCCTACATTGGGTCGCGTCAAGCTCTGTGATTTACTTCCCACCGAAGGCTTACCTTCCGATTC
CTACAAGCTAGCCGTCTCAACACTATCTCAATCCTTAGCACAATACTCCGCCGCAATCATCCAGTTCCCCTCCGCCGACG
CAGCCCTCCTCAGATCCGGCCTCGACTCCGCAAGACTCTATTTCCACCAACGTGACTCGTACCCCTCCACAAACGACTCG
AGAGAATGGTGCAAAACCTCTGGATACTACTCAGACCCTCACTCATGGCAAGAGAGCTACGAGTACAGACCTGGCTTGAC
CTTCACCGAGGCGGCTGCTGCCTCCATGGAGTTCCCTCCTTCTGGTTTGCCTGACATCTTTGGTTTGTTAGGGAAAGCTT
CTCGTTTGGTTCTTGACGCGATTGGTTTCTATCTGAATCTGAGAAGCTCTCCTTTTACCGAGATTCTTGATAATGTCCCC
TTGAGGAGTAACGAGGTTTCTTCCTCCGTGTTGTCTGTTTGCTGCTACGCGAGGCCTTCGTTTCATCATCATCATAACTT
GGCTGAAGACGAGCAGCTTCTCTTGTACTCAGATCACGACCACCAGCTCGACAAGAGTCTGATCTCCTTTGTGAAGTCGG
ATAAGGCCGGGCTGCACGTTAGGGACATGCACGGGCAGTGGATTCTGGTGGATGTGGATCTTGGGCCTCAAGAGGCTGTT
GTCTACCCGGGGCTGGCTCTTTACCAGGCGACGGCTGGCTATGTGAGTCCTGCGGTGTATAGAACTGATTTTAACAGTAT
GCAAGGGAGTATAGAAGGGAGATTCTCCTTGGCTTTTAAACTCATGCCTAAGTCGATGACTAATCTGAGCTGCTCGGAGA
TGAGAGCGGCGGGACATGGTGTTGATGCTCAGTTTCTGATTCCGGTTTCGGTTGATGACTTTATGCAGAGGCCTCACTCG
AATGATGAGCTCTTTAACAGACAGACTTTGCAGAGCTTCACTGTCCCTCAGTCACAGGATGGATCTATGAAACAGATGAA
AAAGAGGAAGAAGAGCGACTCAAGATTAAAACCTCTCCCACCATCGAAGCGGCTGAGGTTAGAAGCGCAGAGAGTTCTCA
AGGAACGAGTTCAGGAGATTGCAGATAAGAAAGGAATCAAGCTCAGATTCTGCAACCCCAAGGACTGCGAGAGTAACCAC
AATACAATGAACAGCCCTTGCGCGCATATTAAAATGGAGATAGGCTGGCCTCAGGGAGTTCCATTTGTTCATCCTCACGA
CCTCCCAAACAAAGCTAAAATCGGGTTCCTTGAGACGTATGAGCCAGGATGGTCTGAAACACATTATATGGAGCTTAGTC
TCTCAGAAGCCGCTCAAGGAAACCAACACGTGACTTAA