Details for Kale Locus Bo5g133000

Position : C5 ( 5`- 41405139 .. 41406245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g133000

Protein [Map View]
MTSVCVKNVGTSPEKLPPASHSRKSSKTSVMSLESQPVDPQLEDPVDFEFLLEDPVTMLTADELFSDGKLVPLKFSSGTN
PEEKPMVPAVNTVLEKPCRRLEMEIDPYLFSPRAPRCTVRWRELLGLKRLNKTPEEASPPSSSSSRLSSSTPNPKTSSFR
QFLNRSSKSTTASPPQAMIKDSDISESSTSISSSRLSLSSSSSSGHELDDVPRLSLDLDNKPNAPNPFARSRAHHHLRNQ
RKPRRHDETTESSNDTRALTVTADSPRLNASGKIVFHGLERSSSSPGNFTGGPRMKQHHGMPRSQSAHVRITPVLNVPVS
SLRGGPKSGLFFGQLFTSSTSANRAQLQSSNTAKSRTNRTRLEPTSET*

DNA
ATGACGTCGGTTTGCGTTAAAAACGTTGGTACTTCTCCGGAGAAGCTACCCCCGGCGAGTCACTCTCGGAAGAGCTCCAA
AACATCAGTTATGAGCCTTGAATCTCAACCGGTGGATCCTCAGTTGGAAGATCCAGTGGACTTTGAGTTTCTTCTCGAAG
ATCCCGTCACAATGCTAACCGCCGACGAGCTTTTCTCCGACGGAAAGCTAGTCCCGCTTAAATTCTCCAGCGGGACTAAT
CCGGAGGAGAAGCCTATGGTTCCGGCGGTTAACACAGTACTGGAGAAACCATGCCGAAGATTGGAGATGGAGATCGATCC
TTACCTCTTCTCCCCGAGAGCTCCTCGCTGCACCGTGAGGTGGCGTGAGTTATTGGGCCTTAAGAGACTCAACAAAACGC
CGGAAGAAGCTTCCCCACCGTCGTCGTCGTCGTCGCGGTTGTCTTCTTCAACTCCAAATCCCAAGACGAGCTCGTTTAGG
CAGTTTCTCAACCGGAGCTCCAAATCTACAACCGCATCTCCTCCTCAGGCGATGATAAAAGACTCAGACATCTCCGAGTC
GTCAACGTCGATCTCCTCCTCCCGTCTCTCCCTCTCGTCTTCGTCTTCCTCCGGCCACGAGCTCGACGACGTTCCTAGAC
TCTCTCTAGATCTCGACAACAAACCCAACGCTCCAAACCCCTTCGCTAGGTCACGTGCACACCACCACTTGCGCAACCAA
AGGAAGCCACGGCGTCATGATGAGACCACGGAGAGTAGTAATGACACGAGGGCGTTGACGGTGACGGCGGATAGTCCGAG
ACTCAACGCTTCGGGGAAGATCGTGTTCCATGGACTCGAGAGAAGCTCCAGCAGTCCCGGTAACTTCACCGGCGGACCGA
GGATGAAACAGCACCATGGGATGCCGAGATCTCAGTCCGCACACGTCAGAATCACTCCCGTACTTAACGTTCCCGTCTCT
TCTCTCCGTGGTGGGCCCAAGTCAGGTCTCTTCTTCGGCCAGCTTTTCACTTCATCTACGTCTGCGAACAGAGCACAGTT
ACAGAGCAGCAACACTGCCAAGAGCCGTACCAATCGAACCAGGCTTGAACCGACTAGCGAAACCTAA