Details for Kale Locus Bo5g132990

Position : C5 ( 5`- 41399124 .. 41401096 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132990

Protein [Map View]
MEAEEENKGSISMVEAKLPPGFRFHPRDDELVCDYLMKRNVRSRYQPVVLIEVDLNKCEPWDIPQSARVGGKEWYFYSQK
DRKYATGQRTNRATAIGYWKATGKDRAIQRNGSLVGMRKTLVFYIGRAPKGRKTDWVMHEFRLQGTFIHHSPKEEWVLCR
AFNKNNNEVDKDNNMRTCSHETAPPLMDSYINFNPHHIINQQVPCFSNLSQNQIGLVYKNPNLLSTNPSSDQMVLKALLR
QLTKNTKESQSYGEGSSESQLTDVGIPSHDAWKY*

DNA
ATGGAAGCTGAAGAGGAGAATAAGGGCAGTATAAGTATGGTCGAGGCTAAGCTGCCTCCTGGGTTTAGATTCCACCCGAG
AGACGACGAGCTTGTCTGCGACTACTTAATGAAAAGAAACGTTCGCAGCCGCTATCAACCAGTTGTCTTGATCGAAGTCG
ATCTCAACAAGTGCGAGCCTTGGGACATTCCTCAATCGGCGAGAGTAGGAGGTAAAGAATGGTATTTTTACAGCCAAAAA
GATCGGAAATACGCAACAGGGCAAAGAACAAACCGGGCTACGGCCATCGGTTATTGGAAAGCAACCGGTAAAGATAGAGC
AATCCAAAGAAATGGTAGCCTTGTGGGCATGAGAAAGACACTTGTGTTTTACATAGGTCGAGCCCCTAAGGGTCGTAAAA
CTGATTGGGTCATGCACGAGTTTCGTCTCCAAGGAACTTTTATCCACCACTCTCCCAAGGAAGAATGGGTCTTGTGTAGA
GCTTTCAACAAGAACAACAATGAAGTCGACAAGGACAACAACATGAGAACCTGCTCTCATGAAACAGCTCCTCCATTAAT
GGACTCTTACATCAATTTCAATCCTCATCACATCATCAACCAGCAAGTGCCCTGCTTCTCCAATCTGTCACAGAATCAAA
TCGGTTTGGTCTACAAGAATCCCAACCTGTTGTCTACTAATCCTTCATCTGATCAGATGGTTCTCAAAGCTTTGCTACGT
CAGCTCACCAAGAATACCAAAGAATCACAGAGCTATGGAGAAGGAAGCTCAGAGAGCCAGTTGACCGACGTTGGCATACC
AAGCCATGATGCTTGGAAATATTGA