Details for Kale Locus Bo5g132970

Position : C5 ( 5`- 41388607 .. 41390982 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132970

Protein [Map View]
MVITTKLQILRMFDSQVLKSNSGGIERCQESTSGESFLYRYQLEEDVKRLQLQLQEEIELHTFLESVMEKDPWQLSSSSC
SVPHQAQELLSNISTLETAVTKLEQEMMSLNFQLSQERNERRLAEYHLTHSASPPNISSSLIYLNHSDSELHRSAEDSSC
QNQDSSSESSQAESTVKKSNQILEKRLMRKTNGRKLLKYLWDHPNLLSEEMVRCMKNIFMSLADQTKASSNESQLLSPVA
SPRGHLSSSSSWWPSTERSKISSWVQSPQIDIQSNNNVLAATGNVFDPYKVRGKLSWAEIGNYGLASEVSWMSVGKKQLE
YASGALRRFRTLVEQLARVNPIHLSCDEKLAFWINVYNALIMHAYLAYGVPKSDLKLFSLMQKAAYTVGGHSYTAAAMEY
VILKMKPPTHRPQIALLLAINKVKVSEEQRKASIDRHEPLLSFALSCGMYSSPAVRIYTAKRVKEELQEAQREFIQASVG
LSSKGKLLVPKMLHCYAKSLVEDSNLGVWISKYLPPHQAAFVEQCISQRRRQSLLSSRNCGILPFDSRFRYLFLPDNNNN
SCV*

DNA
ATGGTAATAACTACCAAACTCCAGATCCTTAGGATGTTTGACTCTCAAGTTTTGAAATCTAATTCAGGGGGCATAGAGAG
ATGCCAAGAGTCTACAAGTGGGGAATCGTTTCTGTATAGATACCAACTTGAAGAGGATGTAAAAAGATTGCAACTACAAC
TACAAGAAGAAATAGAGCTGCACACTTTTCTAGAAAGCGTCATGGAGAAAGATCCTTGGCAGCTATCTTCTTCTTCTTGT
AGTGTTCCACATCAAGCTCAAGAACTGCTTTCCAATATATCCACCCTAGAGACTGCAGTCACCAAGCTAGAGCAAGAAAT
GATGTCTCTGAACTTCCAACTTAGCCAAGAAAGAAACGAGAGAAGACTAGCTGAATATCATTTGACACACTCAGCTTCTC
CACCAAACATTTCTTCTTCCTTGATATATTTGAATCATTCGGATTCTGAACTACATCGATCAGCAGAAGACAGTTCATGC
CAAAACCAAGACTCTTCATCTGAATCATCTCAGGCAGAATCAACTGTTAAGAAGAGTAACCAAATTCTTGAGAAGAGACT
AATGAGAAAGACAAATGGGAGGAAGCTACTTAAGTACCTGTGGGATCACCCTAATCTACTCTCTGAAGAAATGGTGAGAT
GTATGAAGAACATCTTCATGTCTCTTGCTGATCAGACAAAAGCATCCTCAAACGAGAGCCAACTCCTCTCACCGGTGGCA
TCACCAAGGGGGCATCTATCAAGCTCATCATCCTGGTGGCCTTCAACAGAACGGTCAAAAATCTCTTCATGGGTGCAAAG
CCCTCAGATAGATATCCAAAGTAACAATAATGTCTTGGCCGCCACAGGAAACGTCTTTGATCCTTACAAAGTTCGTGGGA
AGTTAAGCTGGGCCGAGATTGGAAACTACGGTTTGGCGTCCGAGGTTTCTTGGATGTCTGTTGGGAAGAAACAGCTTGAA
TATGCTTCTGGTGCATTGAGAAGGTTCAGGACACTGGTGGAGCAGCTTGCTAGAGTAAACCCAATCCATTTGAGCTGTGA
TGAGAAGCTAGCTTTCTGGATTAACGTTTATAACGCTTTGATCATGCATGCGTACTTGGCTTATGGTGTGCCAAAAAGTG
ACTTGAAGCTCTTCTCGTTGATGCAAAAGGCTGCCTATACGGTTGGAGGACACTCATATACTGCAGCTGCAATGGAGTAT
GTTATACTAAAGATGAAACCGCCTACGCACAGGCCACAAATTGCTCTGCTTCTTGCCATCAACAAGGTGAAAGTATCAGA
AGAGCAACGTAAGGCAAGCATTGATAGACATGAGCCTCTTCTCTCCTTTGCCTTAAGCTGCGGAATGTACTCTTCCCCTG
CGGTGAGGATCTACACAGCGAAAAGAGTGAAGGAAGAGCTACAAGAAGCTCAAAGGGAGTTCATACAAGCATCGGTAGGG
CTGAGCAGCAAAGGGAAGCTCTTGGTACCCAAAATGCTCCACTGTTACGCAAAGAGTTTGGTGGAGGATTCGAACTTGGG
GGTCTGGATATCGAAGTACCTTCCACCACATCAAGCAGCTTTTGTGGAACAGTGCATCTCTCAGAGAAGAAGACAAAGTC
TTCTCTCCTCACGTAACTGTGGAATACTCCCCTTTGACTCTCGTTTCAGATATCTGTTTCTACCTGACAACAACAACAAC
TCCTGTGTGTAA