Details for Kale Locus Bo5g132960

Position : C5 ( 5`- 41384782 .. 41386673 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132960

Protein [Map View]
MDIHDHGVWVNENERRVRCKHCGKEMTGLNRLKRHLSGTSSRMTPCTQVTLTIREAFRDEVTKEESDLTAAKSKRVGEVQ
MGNDHKRGREEEEEEEDSSRKNESAENEFLLSNKAQKCIGEMKLKIPDSEELNGCMLQEAVEEVQDHVNKIKDSWAITGC
SILLDAWVDQKGHDLVTFVADSPAGPVYLNSFYVSDIKKDVAALTSLVYGVVEDVGVHNVVQIIACSTSGWVGELGQSFK
SNNLNVFWSVSVSHCFELMLVEIVKMESFKYILEKVSNITEFINNNREDSQGMTVSSSEFEFVKPYLAAGTILKAKNNLE
AMVASPDWNKEEGTTVSTLVKDSSFWECVERLVKSTSPLIRSLHLFSTVYNSQHAGYVYDTMDGIKESIAKELNNEELCY
KPLWRVIDDVWNNHLHSPLHVAGYFLNPAAFYSTDFQNDTEVTTDFISALGYLVQECQVIAKIGRQLKMYRLGKGCFNEA
SQADKITGVIPGEWWAQKASEHPELQSFAVKVLSQTCEGASRYKLKRNVAEKLLLSKGVSPCEKQHLEELAFVHYNLHLQ
SSKLQSQTK*

DNA
ATGGACATTCATGATCACGGAGTTTGGGTGAACGAGAACGAAAGGCGTGTTAGATGCAAACACTGCGGTAAAGAAATGAC
CGGCTTGAACCGTCTCAAACGTCACTTGAGTGGTACGAGTAGCCGTATGACTCCCTGTACTCAAGTTACACTGACCATTA
GAGAGGCGTTTCGTGATGAGGTTACTAAGGAAGAGTCTGATCTCACCGCTGCTAAGAGTAAAAGAGTTGGGGAAGTCCAA
ATGGGTAATGATCATAAGCGTGGAAGAGAAGAAGAAGAAGAAGAAGAGGATTCATCCAGAAAAAATGAATCTGCTGAGAA
CGAGTTCTTGTTGTCAAACAAAGCCCAAAAGTGCATTGGTGAGATGAAGCTTAAGATCCCTGATTCTGAAGAATTAAACG
GATGTATGCTTCAAGAAGCGGTGGAGGAAGTGCAAGATCATGTGAACAAGATTAAAGACTCATGGGCCATCACAGGCTGC
AGCATCTTGCTGGATGCTTGGGTTGACCAGAAAGGCCATGATCTGGTTACTTTCGTCGCAGACTCTCCAGCGGGTCCAGT
GTATCTGAACTCCTTCTATGTTTCTGATATCAAGAAAGACGTCGCTGCCTTAACGTCGCTAGTGTATGGGGTTGTTGAGG
ATGTTGGAGTGCATAACGTTGTTCAGATCATTGCTTGTTCAACCTCTGGCTGGGTTGGTGAGCTAGGCCAGTCTTTCAAG
AGCAACAACCTAAACGTCTTCTGGTCCGTGAGTGTGTCCCACTGCTTCGAGCTTATGCTGGTGGAAATTGTGAAAATGGA
GTCGTTTAAATACATACTTGAAAAGGTCAGTAACATCACAGAGTTCATCAACAACAATAGAGAAGATTCTCAAGGCATGA
CAGTCTCCTCCTCTGAGTTTGAGTTTGTTAAGCCGTATCTCGCTGCAGGGACCATTCTCAAAGCCAAGAACAACTTGGAA
GCCATGGTTGCTTCTCCAGATTGGAACAAAGAAGAGGGGACAACAGTGTCCACACTGGTGAAGGATTCTTCCTTTTGGGA
ATGTGTTGAGAGGCTTGTGAAGTCCACATCTCCTCTGATTCGAAGCCTACACTTGTTCTCTACTGTCTACAACAGTCAGC
ATGCTGGATATGTCTATGACACTATGGATGGGATCAAGGAGAGTATAGCCAAGGAACTCAACAACGAGGAACTGTGTTAC
AAGCCGTTATGGCGTGTGATTGATGATGTCTGGAACAACCACCTCCACAGTCCTCTTCATGTTGCCGGTTACTTTCTGAA
CCCGGCTGCTTTCTACTCGACTGACTTTCAGAATGACACAGAAGTTACAACTGATTTTATCTCAGCATTGGGCTATTTAG
TACAAGAATGTCAAGTTATAGCTAAAATTGGCAGACAGCTTAAGATGTATAGGCTCGGTAAAGGTTGCTTTAATGAGGCC
AGTCAAGCTGATAAGATCACTGGAGTCATTCCAGGTGAGTGGTGGGCTCAGAAGGCGAGCGAGCACCCAGAACTGCAGAG
TTTCGCAGTTAAGGTTCTGAGCCAGACATGTGAAGGTGCTTCGAGGTACAAGCTGAAGAGAAACGTAGCAGAGAAGCTGC
TGCTCAGCAAAGGAGTGAGCCCTTGTGAGAAACAGCACTTGGAAGAATTGGCATTTGTTCATTACAATCTTCATCTGCAA
AGCTCAAAGCTGCAAAGCCAAACTAAGTGA