Details for Kale Locus Bo5g132930

Position : C5 ( 5`- 41370273 .. 41373910 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132930

Protein [Map View]
MTGMALELSVLGRSVVSTKASNLKRYGQKPNLSGRLLTRAAELHCPVMSSKNSTLSFRFRRSCELSSSYRSRFMLFSSSQ
CHDGGSQRSPDSELEWIKVLLKRGIVIGAVVCGVYLYGCKKVLASSGVVEAGYEVFGQSLVLFKNALPKIYQVLKVLREQ
GLILAALFGLSAFFSMAETSITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIFG
EAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYLSMGILKLLGLKGRSEPYVTED
ELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLIDVVAIDASGSLVDFHSMWVTHQYSRVPVFEQRIDNIVG
IAYAMDLLDYVQKGDLLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEI
FDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNIKMPEGIQYETVSGFVCEAFGYIPKTGESVKVVLEKENW
EEDGEEEEGNKQEKQEQKEKHQIYRVEILAGNARKVSAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNSSYQE
KTEDAVSDDEHVVADNSNKQH*

DNA
ATGACGGGTATGGCACTTGAGTTATCGGTTCTGGGTCGGTCTGTTGTCAGCACAAAAGCCTCAAACTTGAAGAGATATGG
TCAAAAACCAAACCTTTCTGGTAGACTTCTCACGAGAGCTGCTGAGCTGCACTGCCCTGTGATGTCGTCTAAAAACTCCA
CTTTGAGTTTTAGATTCCGACGAAGCTGTGAACTTAGCAGCAGCTACAGAAGTCGCTTTATGCTGTTTAGCTCGAGTCAA
TGTCACGACGGTGGTAGTCAACGAAGTCCCGATTCTGAGCTGGAGTGGATTAAGGTTTTGCTGAAACGTGGGATTGTTAT
AGGAGCTGTGGTGTGTGGAGTTTACTTGTATGGATGTAAAAAGGTGTTGGCATCGAGCGGTGTGGTGGAAGCAGGGTATG
AGGTGTTTGGTCAGAGCCTAGTCTTGTTCAAGAATGCTTTGCCGAAAATTTACCAGGTTCTTAAGGTTCTTAGAGAGCAA
GGTCTTATATTGGCTGCACTGTTCGGCCTCTCAGCGTTCTTCTCTATGGCAGAGACGTCCATCACCACTCTGTGGCCCTG
GAAGGTGCGTGAGCTGGCTGAGAAAGAGCCAGAGAATGGTGTATTCAGAATGCTCCGTAGCGATGTTACCAGATTCCTGA
CGACTATTCTAATTGGAACAACTGTTGTGAATATTGCGGCAACTGCCCTGGTCACTGAAGCAGCAACGGCTATATTTGGG
GAAGCTGGTGTTAGTGCAGCCACTGGACTGATGACGGTGGCTATATTGCTTCTAACTGAGATTACTCCAAAAAGTGTTGC
TGTACACAATGCTCAAGAAGTTGCAAGGATTGTGGTCAGGCCAGTGGCGTGGCTTTCCTTAGTATTATATCCTGTGGGAA
GAATTGTCACGTATCTGTCAATGGGAATACTGAAACTTCTTGGTTTAAAAGGACGGAGTGAGCCATATGTTACTGAAGAT
GAGTTGAAACTGATGCTAAGGGGTGCAGAGTTAAGTGGCGCCATTGAAGAAGAGGAGCAGGATATGATTGAAAATGTGCT
GGAGATAAAAGATACACATGTTCGAGAGGTGATGACTCCTCTTATTGATGTAGTTGCTATTGACGCCAGCGGCAGTCTAG
TTGATTTCCATAGCATGTGGGTGACCCATCAGTACTCGAGGGTGCCTGTTTTTGAGCAGCGTATAGATAACATAGTGGGA
ATCGCATATGCTATGGATCTTCTAGATTATGTTCAGAAGGGTGATCTGCTAGAGAGTACTTCTGTGGGAGACATGGCACA
TAAACCTGCCTACTTTGTCCCCGATTCAATGTCAGTATGGAATCTTCTTAGAGAATTTCGCATAAGAAAGGTTCACATGG
CAGTAGTCCTTAACGAATATGGTGGAACCATTGGTATAGTAACTCTTGAAGATGTGGTGGAAGAGATTGTTGGTGAAATA
TTTGATGAAAATGATTCTAAAGAGGAGATTCAGAAGAAGACAGGGTATATTGTGATGAGAGATGAGGGAGTCTATGATGT
TGATGCTAATACATCAATTGATCAGCTATCCGAAGAACTGAATATAAAGATGCCAGAGGGGATTCAGTATGAGACGGTCT
CAGGCTTTGTGTGTGAGGCCTTTGGTTATATCCCAAAAACGGGAGAAAGTGTAAAGGTTGTTCTTGAGAAGGAAAATTGG
GAAGAGGATGGTGAAGAAGAGGAAGGTAACAAACAGGAGAAGCAGGAGCAGAAGGAAAAGCACCAAATCTATAGAGTTGA
GATACTAGCAGGGAATGCAAGAAAAGTGAGTGCTGTCAGGTTTGAAAGAGTCAACGACATGGATCAAGTGTCGGAGGCAA
AAGATGTAAGAAGCATGGTTCCTAAGTTTGTGAGGAAATGGAGCAGTGAAGAGGATGATGGGAATTCGTCGTACCAAGAA
AAAACCGAGGATGCCGTCTCAGATGATGAACATGTAGTGGCTGATAACAGCAACAAACAACATTGA