Details for Kale Locus Bo5g132910

Position : C5 ( 5`- 41353528 .. 41354490 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132910

Protein [Map View]
MAVSSVTSFMLPSFVNPTSSSSSRQKVSLLSLLPSSSTHGDIGSCVLNKPSISFTKKVFAAPETLTPETLDEPTSEEFSE
VPSSPSISVDADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDARFHFE
IRTHQRMIDILYPTAQTIDSLMQLDLPAGVDVEVKL*

DNA
ATGGCGGTTTCTTCCGTAACTTCGTTCATGTTACCCTCTTTCGTCAACCCTACCTCTTCTTCTTCGTCCAGACAGAAAGT
CTCTCTGCTTTCACTGCTTCCATCTTCTTCTACTCATGGCGACATTGGCTCTTGCGTCCTTAACAAACCCTCCATCTCGT
TTACGAAGAAGGTCTTCGCAGCTCCCGAAACCCTAACTCCAGAAACTCTCGATGAACCCACCTCTGAGGAATTCTCCGAG
GTTCCAAGCTCTCCCTCCATAAGTGTAGACGCAGATAAGATGGCGCCAAAGCAAAAGATTAGGATCAAGCTTAGATCTTA
CTGGGTGCCTCTTATTGAGGACTCATGCAAGCAGATACTCGACGCTGCGAGGAACACCAATGCCAAGACGATGGGTCCTG
TTCCATTGCCTACCAAGAAGCGTATCTACTGTGTTCTCAAGTCTCCCCACGTTCACAAGGATGCAAGGTTCCACTTTGAG
ATCCGGACTCACCAGCGGATGATTGATATTCTCTACCCTACTGCTCAAACAATCGACTCCTTGATGCAACTGGATCTTCC
CGCTGGTGTTGATGTGGAAGTGAAGCTCTGA