Details for Kale Locus Bo5g132900

Position : C5 ( 5`- 41345740 .. 41346336 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132900

Protein [Map View]
MNRIKPEFMKKLTKFIVISIWVSSLLITHNFYLCKLTIQLVTHAVDKMYMFLVCNGLLVFVAKYSGLISSSKPVEESWSN
TDQTFDHRDFDSYDATLELEYYSDHDRGTMTFLAEEVSTQDQETEEEKEDEDEDEESEETLETNGGLEEECDIQGKFKEE
EDNVGVVMEEDMNKKFDEFIRKMKEELRLEAKQHLILV*

DNA
ATGAATCGAATAAAACCTGAGTTTATGAAGAAACTGACCAAGTTCATAGTGATTTCGATATGGGTTTCATCTCTTTTAAT
CACTCACAACTTCTATTTATGTAAACTCACAATTCAACTCGTAACACACGCGGTAGATAAGATGTACATGTTTCTCGTCT
GCAATGGTCTCTTAGTGTTTGTCGCTAAGTACTCTGGTTTAATATCTTCATCAAAACCTGTAGAGGAAAGCTGGAGCAAC
ACCGATCAAACCTTTGATCACAGAGACTTTGATAGTTACGATGCGACGTTGGAGCTAGAGTACTACTCTGATCATGATAG
AGGAACAATGACTTTTCTTGCAGAGGAAGTTAGTACACAAGACCAAGAAACCGAAGAAGAGAAGGAAGATGAAGATGAAG
ATGAAGAATCTGAAGAGACATTAGAAACTAATGGTGGTCTAGAGGAAGAGTGTGATATTCAAGGCAAATTTAAAGAAGAG
GAAGATAATGTGGGAGTGGTGATGGAGGAAGATATGAACAAGAAGTTCGATGAGTTCATTAGAAAGATGAAGGAAGAGCT
TAGACTCGAAGCTAAACAGCATCTAATCCTTGTTTGA