Details for Kale Locus Bo5g132840

Position : C5 ( 5`- 41324791 .. 41325879 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132840

Protein [Map View]
MATFHSVQHAVKLFNAGLPCGEHLNKRQEQEVLVEETDVNKLKAKIKNAEMAKIEALLELEEAKKTVEHLNHKLEIRNKS
DEKGLALRSISSNVRDVTSELGIAKELLQRVVAQEESRQDLDVSSSNNVIVVTSELGFAKESLHRAAEEESGLCLLMESL
KLELENVKKEHSELKEKEQRETEQAVEELKKEAEEAKRELLQLEEELIKIALKEAQEAKAVEEHEAEECLNNVQESCGGG
LSETEALRACRDETLKKLEMSEKEIEDIKAATQEALKKAEMAEEATIVVDAELKRRRKAASRMWAKSFPSAKEVDKSKSR
SKETCLVKC*

DNA
ATGGCTACTTTTCATTCTGTTCAACATGCAGTGAAGCTCTTCAACGCTGGTTTACCTTGTGGAGAACATCTCAACAAGAG
GCAAGAACAGGAAGTGTTGGTGGAAGAGACAGATGTTAACAAGTTGAAGGCGAAAATAAAGAATGCAGAGATGGCGAAGA
TTGAGGCTTTGTTAGAGCTTGAGGAAGCTAAAAAAACGGTTGAGCATCTCAATCACAAGCTGGAGATTAGGAATAAGAGT
GATGAGAAAGGTTTAGCTTTGAGAAGTATTAGTAGTAATGTGAGAGACGTGACTTCAGAGCTAGGCATTGCTAAAGAATT
GCTTCAAAGAGTAGTAGCTCAAGAGGAGAGTCGTCAGGACTTAGATGTGAGTAGTAGTAATAATGTGATAGTTGTGACTT
CTGAGCTAGGCTTTGCTAAGGAATCACTTCATAGAGCAGCTGAAGAGGAGAGTGGACTGTGTTTGTTAATGGAGTCTCTC
AAGCTCGAGCTTGAAAACGTTAAGAAAGAGCATTCAGAGCTTAAGGAGAAAGAGCAGAGAGAAACGGAACAAGCCGTTGA
GGAGCTGAAGAAGGAAGCTGAAGAAGCAAAGAGGGAGCTTTTGCAGTTAGAGGAAGAGCTCATCAAGATCGCTCTTAAGG
AGGCCCAAGAAGCAAAAGCTGTAGAGGAACACGAAGCTGAGGAATGTCTAAACAACGTTCAAGAAAGTTGTGGTGGTGGA
TTAAGTGAGACGGAAGCATTGAGAGCATGCAGAGATGAAACACTCAAGAAACTAGAGATGAGCGAGAAGGAGATTGAAGA
TATCAAAGCAGCAACGCAAGAGGCGTTGAAGAAGGCAGAGATGGCTGAGGAAGCTACAATTGTGGTGGACGCAGAGCTTA
AAAGACGGCGTAAGGCAGCTAGTAGGATGTGGGCTAAGTCGTTTCCCTCTGCAAAGGAAGTGGACAAGTCGAAATCGAGA
TCCAAAGAGACTTGTTTAGTCAAGTGTTAG