Details for Kale Locus Bo5g132810

Position : C5 ( 5`- 41309900 .. 41311632 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132810

Protein [Map View]
MSDDENDDDDEDDTEALMAELDQIKSGGEAQEGKLTLEKQQQMEELNAKEEELLKGNPLLNNAPTSWDDDVVFKNQARGE
MKAPKRFINDTIRNDFHRKFLHRYMNTKSNPSKLSIVPEQSNLLLEDEKEAGDCPREPSHVVDNDHVNNTANAKVSSTVF
LLTLSVNLPPIIFKRVVLPLPEGPISARISPGRVLPVIPFNMCLYPS*

DNA
ATGAGTGATGACGAAAATGATGATGATGACGAGGACGACACTGAAGCTCTCATGGCTGAACTCGACCAGATAAAGAGCGG
AGGAGAGGCTCAGGAAGGTAAACTTACTCTTGAAAAGCAGCAGCAGATGGAGGAGCTAAACGCCAAAGAAGAAGAGCTTC
TCAAAGGAAACCCACTGCTTAACAACGCTCCAACCTCGTGGGATGACGATGTGGTGTTCAAGAATCAGGCTCGTGGTGAA
ATGAAAGCACCAAAGCGCTTCATCAATGATACAATAAGGAATGACTTCCACAGAAAATTCCTACACAGATACATGAATAC
AAAGAGTAATCCATCCAAGTTATCTATTGTACCTGAACAGAGTAACCTTCTGTTAGAAGATGAAAAGGAAGCAGGGGACT
GTCCTCGTGAACCCAGCCATGTAGTTGACAATGATCATGTCAACAACACAGCAAATGCCAAGGTCTCTTCCACAGTCTTC
CTTTTGACATTATCTGTCAATCTTCCTCCCATTATCTTCAAGAGAGTGGTTTTGCCACTACCTGAAGGACCCATTAGTGC
AAGGATTTCTCCTGGACGCGTGCTTCCTGTTATACCTTTCAATATGTGCTTGTACCCATCTTGA