Details for Kale Locus Bo5g132780

Position : C5 ( 5`- 41298600 .. 41298932 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132780

Protein [Map View]
MEGKEKEKEEAKRTMIMKINKLKETPQEISQEDAKRQEAYNMSPRVRGGSGSAGMGKSSSVRLNCLCAPTTHPGSFRCRY
HRRNSALGMSRGISVPSNLSMLGGGGSPKS*

DNA
ATGGAAGGGAAAGAGAAAGAGAAAGAAGAAGCGAAGAGGACAATGATCATGAAGATCAACAAACTCAAGGAGACACCTCA
AGAGATAAGCCAAGAAGACGCTAAAAGACAAGAAGCTTACAACATGTCTCCACGTGTACGTGGTGGTAGTGGCTCTGCGG
GTATGGGAAAGTCATCGAGCGTGAGGCTAAACTGTTTATGCGCACCAACAACACACCCTGGCTCCTTCAGGTGCCGTTAC
CACCGTCGCAACTCTGCACTCGGAATGTCACGTGGCATATCTGTTCCCTCTAACCTTTCCATGTTGGGAGGAGGAGGCTC
TCCTAAATCCTAA