Details for Kale Locus Bo5g132760

Position : C5 ( 5`- 41292331 .. 41292525 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132760

Protein [Map View]
MCCGRICMLCTCLILVVIAIGFLFGFGVFKDGFHKIQQSVHLECDQRSGCGGGGRRGYGFPGNN*

DNA
ATGTGTTGTGGAAGGATATGCATGCTGTGCACGTGTTTGATTCTGGTGGTGATCGCGATCGGGTTCCTATTCGGATTCGG
AGTTTTCAAGGATGGTTTCCACAAGATCCAACAGTCCGTCCATCTCGAATGCGATCAGAGATCCGGCTGCGGCGGAGGTG
GACGTCGCGGTTACGGTTTCCCCGGCAATAACTAG