Details for Kale Locus Bo5g132650

Position : C5 ( 5`- 41237504 .. 41243134 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132650

Protein [Map View]
MASSPGNPNPNNPPPFDLGTLFKPSSSPFPTPPASYPPPAGPFLQQPYPPPPQQQEAAPSSSSSLLQQQRSLPFPSPPLN
LPQSPSPRASANHNPGTHILALLNNNNNNGATNQDPPPQHQAPVASPHEIRSFPSSPVRVPSCKLPRGRRLSGEHAVYDV
DVRLHGEIQPQLEVTPITKYGSDPQLVVGRQIAVNKIYICYGLKGGNIRVLNINTALRALFRGHSQRVTDMAFFAHDVHL
LASVSLDGKVFVWKISEGSEGDDDPQITGKIVLALQILGEEDTKHPRVCWHSHKQEILVVSIGKHVLLIDTTKVGRGEVF
SSESPIQCHLDKLVDGVKIVGKHDGEVTDLSMCQWMITRLVSSSVDGTVKIWQDFKAQPVAVLRPHDGHPVNSATFVTSP
ERSDHVILITGGPLNREMKIWVPTGEEGWLLPAESESWNCTQKLDLKSSTEPRAEMAFFNQVIALSEAGLLLLANAKRNA
IYAVHLDYGSSPADTRMDYLSEFTVTMPILSFIGTNDPPEEAVVKVYCVQTQAIQQYTLDLCLCLPPPIEESVGLEKSDS
SVSREANLVEGISKPSGMKLTDLPSADSVPKPSILVNRSKGANTSTYLAGSASVETTAPVLVSSNGEPKASGLLSETSAA
GSAYATSPQLPLSPRLSSTLCGHQTPVDVIEPMLPHHELGGQGPSVYSVDRQADPVKERNLEESSRSKDKDVTPADDVSG
MRTPQAFFKHPTHLVTPSEFLMRVSSAEASITTEDKRDRDANIQDVNIDSRDTEVEVKEVGESSSTQNGEINYSDETEHR
TSVNTEKIFYSQTTNLSTEMARDCYPGTELEESKAYEQSVQAGDNLESRDVSGKLPESVSSIGLPQSAATNKGKKQKSKS
SQGPGLSSTSSNVANLADTYNEQTQSSSQPILALQETMNQMMVSQKEMMVSQKEMQRQLSNAVNGPVTKEGKRLEVAIGR
MIERSSKSNADALWARLQEEIVKNEKAMRDNSQQIVNAVTNFMSKELNALFEKTIKKEIATNIPAIARALSPAIEKTVSS
SVTESFQRGLGDKSVNQLDKSVNSKLEATITKQIQTQFQTSGRQALQEALRSGLEASLIPSFERSCKTMFEQVDAAFQKG
MAEHTNAAQQRFDAGHSQLAHTLKETITSASSVAQALSRELAESQRNRLALAAAGANSSGSNTLVSQRSSGPLGALLEKV
EADPITELSRLILERKYEESFTSALYRSDVSIVSWLCSQVDLRGLLAMNPLPLSQGVLLSLLQQLAFDISKDSSRKLAWM
TDVVAAINPSDPMVAVHGRPIFEQVYQILHHHRNTPGSDVSATRLIMHVINSMLMACK*

DNA
ATGGCCTCTTCACCTGGAAACCCTAACCCTAACAATCCTCCGCCGTTCGATCTCGGTACTCTCTTCAAACCTTCGTCGAG
TCCTTTCCCCACGCCGCCGGCGTCGTATCCTCCCCCCGCGGGTCCGTTTCTTCAGCAGCCCTACCCCCCTCCGCCGCAGC
AACAGGAGGCCGCGCCTTCCTCTTCGAGTAGCCTTCTCCAACAACAGAGATCACTCCCTTTCCCCTCGCCGCCTCTGAAT
CTCCCCCAGTCGCCGTCGCCGCGTGCTAGTGCTAATCACAATCCCGGTACACACATCCTGGCTCTCCTCAACAACAACAA
CAACAACGGCGCGACCAATCAAGATCCGCCGCCGCAGCATCAGGCTCCCGTGGCGAGTCCGCACGAGATCCGCTCGTTTC
CTTCGAGTCCTGTTCGCGTGCCGAGCTGTAAGCTTCCCAGAGGGAGGCGGTTGAGCGGGGAACACGCTGTGTACGATGTC
GACGTGAGGTTACACGGCGAGATTCAGCCTCAGCTTGAGGTTACTCCGATTACCAAATACGGGTCGGATCCTCAGCTCGT
TGTGGGTCGCCAAATCGCAGTGAACAAGATCTACATATGCTATGGATTGAAAGGAGGAAACATTCGTGTTCTCAATATTA
ACACCGCTTTAAGAGCTTTATTCCGAGGCCATTCTCAGCGAGTGACAGACATGGCCTTCTTTGCTCATGATGTTCATCTC
CTGGCTAGTGTTAGCTTAGATGGAAAAGTTTTCGTGTGGAAAATATCTGAAGGGTCTGAGGGAGATGATGACCCCCAGAT
AACTGGAAAGATTGTCCTTGCTCTTCAGATACTTGGTGAGGAAGACACCAAACATCCACGTGTTTGTTGGCACTCCCACA
AACAGGAAATTTTGGTGGTTTCAATTGGTAAACACGTCCTCCTAATTGATACTACCAAAGTTGGCAGAGGTGAAGTATTC
TCGTCTGAGTCTCCGATTCAGTGCCACCTTGATAAATTGGTTGACGGTGTAAAGATTGTTGGCAAGCACGATGGAGAGGT
TACAGATTTATCTATGTGCCAGTGGATGATCACACGCCTCGTTTCTTCTTCTGTTGATGGCACGGTTAAGATTTGGCAAG
ATTTCAAGGCCCAACCAGTTGCAGTTCTGAGACCTCATGATGGCCATCCAGTCAATTCGGCAACATTTGTGACATCCCCT
GAGAGATCTGATCACGTCATTCTCATCACTGGGGGTCCTCTAAATCGAGAGATGAAGATTTGGGTCCCGACTGGAGAAGA
AGGATGGCTCCTGCCAGCTGAATCTGAGTCATGGAATTGTACTCAGAAACTTGATTTGAAAAGTTCAACTGAGCCACGAG
CGGAGATGGCGTTTTTCAACCAAGTTATAGCCTTGTCTGAAGCAGGCCTCCTCTTGCTTGCAAATGCGAAAAGGAACGCC
ATATATGCTGTGCATTTGGACTATGGCTCATCTCCAGCTGATACAAGGATGGACTACTTGTCTGAGTTTACAGTCACTAT
GCCGATATTAAGTTTTATCGGGACTAATGATCCTCCAGAAGAAGCCGTTGTTAAGGTTTATTGTGTTCAGACGCAAGCAA
TCCAGCAGTATACATTAGACTTATGCTTGTGTTTGCCTCCTCCTATAGAGGAGAGTGTGGGTTTGGAGAAGTCAGATTCT
AGTGTTTCGCGGGAGGCTAATTTGGTTGAAGGCATATCAAAACCATCTGGAATGAAGCTTACAGATTTACCTTCAGCTGA
TTCAGTGCCTAAACCATCTATTTTAGTGAATAGATCGAAAGGTGCTAATACTTCGACTTATTTGGCGGGTTCTGCATCTG
TGGAGACGACAGCACCAGTACTTGTTTCATCCAACGGCGAGCCTAAAGCTTCTGGGCTGCTATCTGAGACCAGTGCTGCA
GGGTCGGCGTATGCTACTTCACCCCAGCTTCCTCTAAGTCCCAGACTATCAAGTACACTTTGTGGCCATCAGACTCCAGT
GGATGTTATTGAGCCAATGCTACCACATCATGAACTCGGTGGTCAAGGACCTTCTGTATATTCTGTTGATAGGCAAGCAG
ATCCTGTTAAAGAAAGAAATTTGGAGGAAAGCTCAAGAAGCAAGGACAAGGATGTTACGCCTGCTGATGATGTGTCTGGG
ATGCGAACCCCACAAGCTTTCTTCAAGCACCCCACGCATCTTGTAACTCCTTCAGAGTTTTTGATGCGCGTTTCGTCTGC
TGAAGCTTCCATTACCACTGAAGACAAAAGGGATAGAGATGCAAATATCCAGGACGTCAATATTGATTCAAGAGACACAG
AAGTTGAGGTAAAAGAAGTAGGGGAATCAAGTTCGACGCAGAATGGTGAAATCAATTACAGTGATGAAACTGAGCATCGC
ACTTCAGTAAATACAGAAAAAATCTTTTACTCACAGACTACGAACCTGAGCACTGAGATGGCAAGAGACTGTTATCCTGG
TACAGAGTTAGAGGAATCTAAGGCTTATGAACAGTCTGTACAAGCTGGGGATAATCTTGAATCGAGAGATGTGTCTGGAA
AGCTTCCTGAGTCGGTTTCATCAATTGGGCTTCCACAGTCAGCCGCTACAAACAAAGGGAAGAAACAGAAGTCCAAAAGC
TCACAGGGTCCCGGATTGTCATCTACATCCTCAAATGTTGCTAATTTGGCTGATACCTACAATGAGCAAACTCAGAGTTC
AAGCCAACCTATCTTAGCTTTGCAAGAAACAATGAATCAGATGATGGTTTCACAGAAGGAGATGATGGTTTCACAGAAGG
AGATGCAGAGACAACTGTCCAATGCTGTCAATGGCCCTGTCACTAAAGAAGGTAAAAGACTAGAAGTGGCTATAGGGAGA
ATGATTGAGAGATCCAGCAAGTCAAATGCTGATGCTCTGTGGGCCCGCTTACAAGAGGAGATCGTTAAGAATGAAAAGGC
AATGCGTGACAATTCACAGCAAATTGTGAATGCAGTGACAAACTTCATGAGCAAAGAGTTAAATGCATTGTTTGAGAAAA
CGATAAAGAAGGAGATTGCTACAAATATTCCAGCCATAGCTCGTGCGTTGTCACCAGCTATTGAAAAAACTGTATCTTCT
TCAGTCACAGAGTCCTTCCAGAGAGGACTTGGTGACAAATCAGTCAATCAGCTTGATAAATCTGTTAATTCAAAGCTTGA
GGCAACCATAACTAAGCAAATTCAAACCCAATTTCAGACATCTGGCAGGCAAGCCCTCCAGGAAGCTCTTAGGTCGGGTC
TGGAGGCCTCGCTCATACCTTCCTTTGAGAGGTCATGCAAGACCATGTTTGAGCAAGTAGACGCAGCCTTCCAGAAAGGG
ATGGCCGAGCACACAAACGCAGCCCAACAACGGTTTGACGCTGGACACTCCCAACTTGCTCATACTTTAAAGGAAACCAT
TACTTCTGCGTCGTCAGTTGCTCAAGCATTGAGCCGTGAATTAGCGGAGAGCCAAAGGAATCGCTTAGCTCTCGCCGCCG
CTGGAGCAAATTCTAGTGGATCAAACACCTTGGTTTCTCAACGAAGTAGTGGACCTTTGGGTGCTCTTCTTGAAAAGGTT
GAAGCAGACCCAATAACAGAACTATCAAGGTTGATATTGGAACGCAAATACGAAGAATCATTTACTTCAGCTTTATATAG
AAGCGATGTCTCCATAGTATCATGGCTCTGCTCACAGGTGGATCTGCGTGGACTACTGGCGATGAACCCGCTTCCTCTGA
GCCAAGGCGTTCTTCTGTCACTGCTGCAACAGCTAGCCTTTGACATCAGCAAGGACTCATCCCGTAAGCTTGCATGGATG
ACCGATGTGGTTGCAGCAATTAACCCATCAGACCCGATGGTTGCTGTCCATGGTCGCCCAATCTTTGAGCAAGTGTATCA
GATTCTGCACCACCACCGCAACACACCAGGCAGCGACGTCTCTGCCACAAGACTTATAATGCACGTGATAAACTCCATGC
TTATGGCCTGCAAATGA