Details for Kale Locus Bo5g132640

Position : C5 ( 5`- 41236369 .. 41236854 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132640

Protein [Map View]
MSGILVYSAASSLRLSPGNSFLESKKTVGSRNGNARFPSGATSVRAYTQQTFNAEPAVTESVRRRASSLYELLKVNETAS
LTEIKTAYRSLAKVYHPDASESDGRDFMEIHKAYATLADPTTRAIYDSTLVTRRRRVHAGAMGRAGRVYTTTRRWETDQC
W*

DNA
ATGTCTGGAATTCTAGTTTATTCCGCCGCTAGCTCCCTTCGACTCTCGCCGGGAAATAGCTTTCTTGAGTCGAAGAAGAC
AGTCGGATCTCGCAACGGAAACGCACGGTTTCCCTCCGGAGCTACGTCGGTCAGGGCTTATACGCAGCAGACATTCAACG
CCGAGCCAGCTGTAACGGAATCCGTTCGCCGGCGAGCGTCGAGCCTCTACGAGCTGCTGAAAGTCAACGAAACGGCGTCG
CTGACGGAGATTAAGACGGCGTACCGGAGCTTAGCGAAGGTTTACCATCCCGATGCGTCGGAGTCTGACGGGCGAGATTT
CATGGAGATCCACAAAGCTTACGCGACGCTGGCGGATCCGACAACGAGAGCTATCTACGATTCGACGCTGGTAACACGGC
GGAGACGGGTTCACGCTGGAGCTATGGGTCGAGCGGGTCGGGTGTACACGACTACCCGGAGGTGGGAGACGGATCAGTGT
TGGTGA