Details for Kale Locus Bo5g132560

Position : C5 ( 5`- 41149357 .. 41151748 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132560

Protein [Map View]
MMQGGKLLTVFVCLVSTVALVNAGDPYFYYTWNVTYGTVAPLGIPQQVILINGQFPGPNLNSTSNNNVVINVFNNLDEPF
LLTWSGLQHRKNSWQDGVTGTSCPIPAGTNYTYHFQPKDQIGSYFYYPSTALHRFSGGFGGLRVNSRLLIPVPYADPEDD
YTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMK
LVEMEGSHVLQNDYDSLDVHVGQCFAVLVTADQTAKNYYMVASTRFLKKEVSTVGVMSYEGSNVQASSELPKAPVGWAWS
LNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVYGKVRFGLNGVSHVDTETPLKLAEYFEMSEKVFKYN
VIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSMQSFHLDGYSFFSVASEPGTWTPEKRNNYNLLDAVSRHTVQV
FPKSWSAILLTFDNAGMWNIRSENWERRYLGQQMYVSDLSPEKSLRDEYNIPLNTNLCGIVKGLPLPTPYTI*

DNA
ATGATGCAGGGTGGTAAGCTTTTGACGGTGTTTGTGTGCCTCGTCTCGACGGTGGCGCTGGTGAATGCCGGTGATCCTTA
CTTCTACTACACGTGGAATGTGACCTACGGAACCGTTGCGCCTCTCGGAATCCCTCAACAGGTGATTCTCATCAACGGAC
AGTTCCCTGGTCCTAACCTAAACTCCACCTCCAACAACAATGTTGTCATCAATGTCTTCAACAACCTTGACGAGCCTTTC
CTCTTGACATGGAGTGGTCTCCAGCACAGAAAGAACTCATGGCAAGATGGTGTGACTGGGACCTCATGCCCAATCCCTGC
AGGCACCAACTACACTTACCATTTCCAGCCAAAGGACCAGATCGGTAGCTACTTCTACTACCCATCAACCGCTCTCCACC
GTTTCTCCGGTGGTTTCGGTGGCCTCCGTGTCAACAGCCGTCTCCTCATCCCCGTCCCTTACGCTGACCCCGAAGATGAC
TACACCGTCCTCATCAACGACTGGTACACCAAGAGCCACACCGCTCTCAAGACCTTCCTCGACAGTGGTCGCACCCTTGG
ATCCCCCGACGGTGTTCTCATCAACGGAAAATCCGGTAAAGTCGGAGGACCAAACGTGCCACTCTTCACCATGAAGCCAG
GAAAGACTTACAAGTACAGGATCTGCAACGTTGGATTCAAATCCACACTTAACTTCAGGATCCAAGGACACAAGATGAAG
CTTGTTGAGATGGAAGGCTCTCACGTTCTCCAGAACGACTACGACTCACTTGACGTCCACGTCGGACAGTGCTTCGCTGT
TCTTGTGACAGCTGACCAAACTGCCAAGAACTACTACATGGTTGCATCCACTAGGTTCCTCAAGAAGGAAGTGAGCACCG
TTGGAGTGATGAGCTACGAAGGAAGCAATGTTCAGGCATCAAGTGAGCTTCCCAAGGCTCCAGTGGGCTGGGCTTGGTCT
CTTAACCAGTTCAGATCCTTCAGGTGGAACTTAACCGCCAGCGCGGCTAGACCTAACCCACAAGGATCTTACCATTACGG
AAAGATCAACATCACACGTACCATCAAGCTCGCCAACACCAAGAACTTGGTGTACGGTAAGGTCAGGTTTGGACTCAACG
GTGTATCACACGTTGACACCGAGACTCCCTTGAAGCTTGCTGAGTACTTCGAGATGTCCGAGAAGGTCTTCAAATACAAC
GTCATCAAGGACGAGCCAGCAGCCAAGATCACAACACTAACGGTCGAGCCTAATGTTTTGAACATCACTTTCCGTACCTT
TGTCGAAATCGTCTTCGAGAACCATGAGAAGAGCATGCAATCCTTCCATTTGGATGGCTACTCATTCTTCTCAGTCGCTT
CTGAGCCAGGAACATGGACACCAGAGAAGAGAAACAACTACAACTTGCTCGATGCAGTCAGCAGACACACCGTGCAAGTG
TTCCCCAAGTCCTGGTCCGCGATCCTCTTGACATTCGACAACGCCGGTATGTGGAACATCAGATCAGAGAACTGGGAGAG
AAGATACTTGGGACAGCAAATGTACGTCAGTGATCTTTCCCCTGAGAAATCACTAAGAGACGAATACAACATCCCACTCA
ACACCAACCTCTGCGGTATCGTCAAGGGCTTGCCATTACCTACACCCTACACTATTTAA