Details for Kale Locus Bo5g132540

Position : C5 ( 5`- 41135474 .. 41140118 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132540

Protein [Map View]
MLCGSLRNRVRNWLRDYVRLQSVVVILIYAQIGCAMVGSLGALYNGVLLINLAIALFALVAIESNSQSLGRTYAVLLFCA
ILLDISWLILFSSEIWNISSEMYKALYIFSVKLTMAMEIAGFVVRLSSSLLWFQIYRLGASIVDTSLPRRSDSDSQNSFV
DPPCLGSQRSRDPDLRTSLLEPSTTAEHRSRSDDFLEDSINGPRSHEILEDSIDGPAYQFPPFDGGQNNLSSPKATHVFR
VMKHHSAENIFGGSQLSAAEASRHKSPLSKSLESLDSSLHRFKRWFSQVSDSRIRNQGLAMEDANAIRYWCHMCSRSVNP
VIEGEVINCNFCQSGFVEEMDETPDQATGDHPHQAVAESLWAPILLGVMNDHDQNQRASESNVENEDGNNDDDDDDDGQI
NDGEFDLERHLEEVMRRRRRHSAAILDLLQGIRAGLSVESENNDDNNQDNELVVLINSFNQRIRIQDSVDASAVPSGSLG
DYFIGPGFEMLLQRLAENDPNNRYGTPPATKEAVESLETVMVEEGLVQCTVCLDDFEIGVEAKEMPCKHKFHSECLLPWL
ELHSSCPVCRYLLPTGDDDGETKTDAETSSNVSMENNGTSVDSSSNNPSVND*

DNA
ATGCTTTGTGGCTCGCTGCGAAATCGAGTACGTAATTGGCTTCGCGACTATGTTAGGCTCCAATCCGTCGTCGTGATCCT
TATCTACGCTCAGATAGGATGCGCGATGGTTGGTTCACTAGGGGCGTTGTACAATGGAGTCCTGCTGATCAATTTGGCGA
TTGCGTTGTTTGCGCTTGTGGCAATCGAGAGCAATAGCCAGAGTCTTGGCCGCACCTATGCCGTTCTTCTTTTCTGCGCC
ATTCTTCTTGATATCTCATGGCTCATTCTCTTCTCCAGTGAGATTTGGAACATTTCATCTGAGATGTATAAAGCCCTTTA
CATCTTCTCCGTGAAACTCACAATGGCTATGGAAATCGCTGGGTTCGTTGTGAGGCTGTCTTCCTCTCTGTTATGGTTTC
AGATTTATAGGCTGGGAGCTTCCATTGTAGACACTTCTCTTCCCCGTCGATCGGATTCAGATTCACAAAATAGCTTCGTC
GATCCTCCTTGTTTAGGTAGCCAACGTTCACGTGATCCTGATCTACGAACTAGCCTGTTAGAGCCTTCTACTACAGCTGA
GCATCGTTCACGTTCTGATGATTTTTTGGAAGACTCTATCAATGGACCACGTTCTCATGAAATCTTGGAAGACTCTATCG
ACGGACCAGCCTACCAGTTTCCTCCATTTGATGGTGGCCAAAACAATCTCTCTTCACCCAAGGCAACACATGTATTCAGG
GTGATGAAACATCATTCAGCTGAAAACATTTTCGGAGGATCCCAATTATCAGCTGCAGAAGCCTCTCGACATAAGTCTCC
ACTATCCAAATCCTTGGAGTCCCTTGATTCTAGTCTCCATCGATTCAAACGCTGGTTTAGTCAAGTCTCTGATTCTAGGA
TTAGAAACCAAGGATTGGCTATGGAGGATGCAAACGCGATTAGGTATTGGTGTCACATGTGCTCTCGATCCGTGAATCCA
GTCATCGAAGGCGAAGTAATCAACTGCAACTTCTGCCAAAGCGGATTCGTCGAAGAAATGGACGAAACTCCAGATCAGGC
CACCGGCGATCATCCTCATCAGGCTGTTGCTGAGTCTCTCTGGGCTCCCATCTTGCTCGGGGTGATGAACGATCATGATC
AGAATCAGAGAGCCTCAGAATCTAATGTCGAAAACGAAGATGGCAACAATGATGACGATGACGATGATGATGGTCAGATT
AACGATGGAGAGTTTGATTTGGAACGGCACCTGGAAGAGGTCATGAGGAGAAGGAGGAGACACTCGGCCGCGATACTCGA
CCTTCTCCAAGGGATCCGAGCCGGGTTATCGGTTGAATCCGAAAACAACGATGATAATAATCAAGATAACGAGCTTGTCG
TCTTGATAAACTCCTTTAACCAGAGGATAAGGATTCAAGACTCCGTCGATGCGAGTGCCGTTCCTTCTGGATCTTTGGGT
GACTATTTCATCGGACCTGGGTTCGAGATGTTGCTTCAGCGTTTGGCTGAGAACGATCCTAACAACAGGTACGGGACGCC
TCCCGCGACGAAGGAAGCTGTTGAGTCGTTGGAGACGGTTATGGTGGAGGAAGGTTTGGTGCAGTGTACTGTGTGTTTGG
ATGATTTTGAGATTGGGGTTGAGGCGAAAGAGATGCCGTGTAAGCATAAGTTTCACAGCGAGTGTTTGTTGCCGTGGCTT
GAGCTTCACAGCTCGTGTCCTGTGTGTAGATATTTGCTTCCTACTGGGGATGATGATGGTGAAACGAAGACTGATGCGGA
GACGTCGAGTAATGTTTCTATGGAGAACAATGGAACGTCGGTAGACTCGAGTTCGAACAATCCATCGGTTAATGATTAA