Details for Kale Locus Bo5g132530

Position : C5 ( 5`- 41131460 .. 41134497 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132530

Protein [Map View]
MSEKPPEIADIMRVSSHREVYEPCDDSFALVDALLADQTNLINHNPNLCMEIGCGSGYVITSLILLLKSKLPTVHYLATD
TNPIAARVTNQTLEAHGVKAEIVCTDIASCLEERLAGSVDVMVVNPPYVPTPEYEVGMEGIASSWAGGENGRSVIDRMLP
VVDRLLSEKGWFYLVTLTSNYPAEICLMMRKRGFAWRILVQRSTEEENLVILKFWRDGDEESLEKETSTASLVSEFSRSL
TSFMEKQWRERQMTDQGLEGSNPVDLAEHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVCTGAKSEYFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELF
PGLIYRMKVPKIVLLIFVSGKIVITGAKMREETYKAFENIYPVLTEFRKIQQ*

DNA
ATGTCCGAGAAGCCACCAGAAATCGCTGACATCATGCGTGTAAGCTCGCATCGTGAAGTGTACGAACCATGCGATGATTC
ATTCGCTCTAGTCGACGCACTACTCGCTGACCAAACCAACCTTATAAACCACAACCCCAACCTTTGTATGGAGATTGGAT
GCGGAAGCGGATACGTCATCACGTCCCTCATCCTCCTCCTCAAATCAAAACTCCCCACCGTTCATTACCTAGCCACCGAC
ACAAACCCAATCGCTGCACGCGTAACAAACCAAACTCTCGAAGCACACGGAGTCAAAGCTGAGATTGTCTGCACGGACAT
AGCTTCTTGTCTAGAAGAGAGACTCGCCGGCTCCGTCGACGTGATGGTGGTGAACCCACCTTACGTTCCTACGCCTGAGT
ACGAAGTTGGAATGGAAGGTATTGCATCTTCTTGGGCTGGAGGGGAGAATGGGAGGAGCGTTATCGACAGGATGTTGCCT
GTGGTTGATCGTTTGCTTTCGGAGAAAGGGTGGTTCTACCTGGTGACGTTGACTTCGAATTACCCGGCGGAGATATGTTT
GATGATGAGGAAGAGAGGCTTCGCGTGGAGGATCTTGGTTCAGAGGTCGACGGAAGAGGAGAATCTCGTTATCCTCAAGT
TCTGGAGAGACGGAGATGAGGAGAGCTTGGAGAAGGAGACGTCAACGGCTTCGTTGGTGTCGGAGTTTTCGAGATCTTTG
ACATCGTTTATGGAGAAACAATGGCGAGAGAGGCAAATGACAGATCAAGGATTGGAAGGGAGTAATCCAGTGGACCTTGC
CGAGCATCCTTCGGGGATTGTGCCTACTCTTCAGAACATTGTGTCAACGGTGAACTTGGACTGCAAGCTTGATCTTAAAG
CCATCGCTTTGCAAGCTCGTAATGCTGAATACAATCCCAAGCGTTTTGCTGCTGTGATCATGCGGATTAGAGAACCAAAG
ACTACAGCATTAATTTTTGCCTCTGGTAAAATGGTTTGTACTGGAGCCAAGAGTGAATACTTTTCAAAGATGGCTGCAAG
AAAGTATGCTCGGATTGTACAAAAGCTTGGCTTTCCTGCAAAATTCAAGGATTTCAAGATTCAGAATATAGTAGGTTCTT
GTGATGTCAAGTTCCCTATCAGACTTGAAGGTCTTGCATACTCTCACGCCGCTTTCTCAAGTTACGAGCCTGAGTTGTTT
CCAGGGTTGATCTACAGGATGAAAGTACCTAAGATTGTGCTACTAATTTTTGTGTCTGGCAAGATAGTCATCACTGGAGC
CAAGATGAGAGAGGAGACTTACAAAGCCTTTGAGAATATATACCCGGTCCTCACAGAGTTCAGGAAGATCCAGCAATAA