Details for Kale Locus Bo5g132500

Position : C5 ( 5`- 41107267 .. 41109265 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132500

Protein [Map View]
MDAFERKYGSHGVNVTSEEEDFEEPVENIGWKHDRQAASKTSDLAGHGVGLAQGFIDECAKVVAAGANPALISIGIEKTE
KALVNELNIMSKGSNAGRNDPEAGSMIAEAMSKVGKNGVVVIDEGKTAENKVYVVEGMQFEPGYMSPYFITDHETERMCV
EYDHFKPLLVDHKITNAKDLDGVLEDAIKGRDPIIIIAEDFEQEAELWNVAAVKAPGGSRELKSKYFDDIAILTGATVIR
EEDGLSLDKAGKEVLGNSYKVVLTKEMTTIVGDGTTHEAVNKRVAEIKNLIEQAEQGYEKETLNERLAKLSGGVAVIQVG
GQTETERREKKLKFEAALNGTKGAIEEGTVVGGGCTFLGLADKVDPIKDTLENEEEKIGADIVKKALSNAGEGGSVVSEE
VVRGSLEHAFSTAKWFLMPDVKGPEARKPVDISG*

DNA
ATGGATGCTTTTGAGAGAAAGTATGGATCACATGGTGTTAATGTTACTTCGGAGGAGGAGGATTTTGAGGAGCCAGTTGA
GAACATTGGTTGGAAGCATGATAGGCAAGCAGCTTCAAAGACCAGTGACTTAGCTGGTCATGGTGTTGGTCTTGCACAAG
GTTTTATCGATGAGTGTGCCAAGGTGGTGGCTGCTGGTGCAAACCCTGCACTGATCTCTATAGGCATTGAGAAGACAGAA
AAGGCTTTGGTTAATGAGCTAAATATAATGTCTAAGGGCAGTAACGCTGGCCGCAACGACCCTGAAGCTGGAAGTATGAT
TGCTGAAGCAATGAGCAAAGTTGGCAAGAACGGTGTGGTGGTCATTGACGAGGGAAAAACCGCTGAGAATAAGGTTTACG
TAGTGGAAGGAATGCAATTTGAACCTGGTTACATGTCCCCATACTTCATAACGGACCATGAGACTGAGAGAATGTGTGTG
GAGTACGATCACTTCAAGCCGCTTCTTGTTGACCATAAGATTACCAATGCAAAGGATCTTGATGGTGTTCTGGAGGATGC
AATTAAAGGTAGAGACCCGATCATCATAATCGCAGAAGACTTTGAACAAGAAGCAGAACTATGGAACGTCGCAGCAGTCA
AGGCTCCTGGTGGTTCTAGAGAGCTAAAGAGCAAATACTTTGACGATATTGCCATTCTAACTGGAGCAACTGTGATAAGA
GAGGAAGATGGTCTTTCTCTGGACAAAGCTGGGAAAGAGGTTTTGGGTAATTCTTATAAAGTTGTCCTCACCAAGGAGAT
GACAACCATTGTGGGTGATGGAACCACACATGAAGCAGTGAACAAGCGTGTTGCAGAGATTAAGAATCTTATTGAGCAAG
CGGAGCAAGGCTATGAGAAGGAGACATTGAACGAGAGACTTGCTAAGCTTTCTGGTGGAGTTGCTGTAATTCAGGTTGGA
GGACAAACTGAGACAGAGCGCAGAGAAAAGAAGCTAAAATTTGAAGCAGCCCTCAACGGTACAAAGGGAGCGATTGAGGA
AGGTACTGTTGTTGGTGGTGGTTGCACTTTCCTTGGCCTTGCGGACAAGGTTGATCCCATCAAGGATACTCTTGAAAACG
AGGAAGAGAAGATTGGAGCAGACATCGTGAAAAAAGCACTGAGTAATGCTGGTGAGGGTGGAAGCGTTGTGAGCGAGGAG
GTTGTGAGAGGTTCCTTGGAACATGCGTTCTCTACTGCAAAGTGGTTCTTGATGCCTGATGTCAAGGGGCCGGAAGCTCG
CAAGCCAGTGGACATCTCTGGTTAG