Details for Kale Locus Bo5g132460

Position : C5 ( 5`- 41082475 .. 41083458 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132460

Protein [Map View]
MIGTYVLMRVLLCKIQCPSFICFCKPSPHIYASGSLKLEDTPPPPPPPPPPPQVSSVVDDGDDDDQFVDAQVEEVVDHVD
GLLNEAREEEGKEEDCALEEGQSNGEILKSSLKKKTLDSEDGERREKKKVQWVDLMGKELAEILKKKRSDMMAIEAVFAL
FCDQFSLVKAMVEGEEAVGLVALEYIELVVHIVVESAIAFLNQSTFASLRLYDVSRYGMVAFCNGFRIVKRIVFYDICFF
DHLVNGSLALIQEALTVIIIFWSCAVSHFKHMVVLTIKSNLEHMQLELL*

DNA
ATGATTGGAACATATGTTTTGATGAGGGTTTTGCTTTGTAAGATCCAGTGCCCTTCTTTCATCTGCTTCTGTAAGCCTTC
TCCTCACATCTACGCATCTGGTTCTCTGAAATTGGAGGACACTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCAAG
TCTCTTCGGTTGTTGATGACGGTGATGATGATGATCAGTTTGTTGATGCACAAGTAGAGGAAGTTGTTGATCACGTTGAT
GGTTTGTTGAATGAGGCTAGAGAAGAAGAGGGAAAGGAAGAAGATTGTGCCTTAGAGGAAGGTCAAAGTAATGGAGAGAT
CCTGAAAAGTAGTCTAAAAAAGAAAACTTTAGATTCAGAGGATGGTGAGAGAAGGGAGAAGAAGAAGGTGCAGTGGGTGG
ATTTGATGGGGAAAGAACTTGCTGAGATCCTGAAGAAGAAGAGATCAGATATGATGGCGATAGAAGCTGTGTTTGCGTTA
TTCTGTGATCAATTCAGTTTGGTTAAGGCAATGGTGGAAGGTGAAGAAGCTGTTGGTCTTGTAGCTTTGGAATACATTGA
GCTAGTAGTACATATAGTAGTAGAATCTGCGATTGCGTTCTTGAACCAATCTACATTTGCTAGCCTGAGGTTATATGATG
TTTCCAGATATGGAATGGTGGCATTCTGTAACGGTTTTAGGATTGTGAAAAGAATTGTTTTCTATGACATTTGTTTCTTT
GACCACTTAGTGAATGGCTCTCTCGCTCTGATTCAAGAAGCTTTGACTGTTATAATTATATTCTGGAGCTGTGCAGTTTC
TCATTTTAAGCATATGGTTGTCTTGACTATCAAATCTAATTTAGAACATATGCAATTAGAGTTGCTTTGA