Details for Kale Locus Bo5g132450

Position : C5 ( 5`- 41077635 .. 41080731 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132450

Protein [Map View]
MEALKVWSLTASPLRQLLRLSSSSTAIYGRRSHHSSLMLRCASAASSSSSSSNAATAETPKPSGRNRRAASSSNSTSDRE
AIRSIRLKKVEELRGQGVEPYAYKWEKSHSANQLQEIYKHLANGEELNDESDRVSIAGRVVARRAFGKLAFLTLRDDSGT
IQLYCEKERLSDEQFEQLKAFIDIGDILGASGSMKRTEKGELSICVSSFSILTKSLLPLPDKYHGLTDIDKRYRQRYVDM
IANPEVADVFRKRAKIVSEIRKTVESSGYLEVETPVLQGAAGGAEARPFVTYHNSLGRDLYLRIATELHLKRMLVGGFEK
VYEIGRIFRNEGLSTRHNPEFTTIEMYEAFSDYQSMMDMAELIVTGCAMAVNGKLTIDYQGTEICLERPWRRETMHNLVK
EATGIDFSELGEDLGKAKDTVLVALQDVLEHKDKSGIGACSSLGHLLNEVFEVVVEPKLVQPTFVLDYPIEISPLAKPHR
GNAGLTERFELFICGREMANAFSELTDPVDQRRRLEEQVRQHNAKRAAAAAETPEGKAKKDDDDDDESYEVTLDEDFLTA
LEYGMPPASGMGLGIDRLGMLLTNSASIRDVIAFPVLKVQQ*

DNA
ATGGAGGCCCTGAAAGTATGGAGTCTAACGGCGTCGCCATTGAGGCAATTACTTCGTCTATCTTCTTCTTCTACCGCAAT
ATACGGAAGAAGATCCCACCACTCATCACTGATGCTCCGATGCGCCTCCGCCGCTTCTTCTTCTTCTTCTTCCTCAAATG
CCGCCACGGCTGAAACTCCCAAACCCTCCGGCCGAAACAGAAGGGCGGCTTCTTCTTCTAATTCCACCTCCGATCGTGAA
GCTATCCGCTCAATTCGTCTAAAAAAGGTTGAAGAGCTGAGAGGTCAAGGTGTAGAGCCATATGCTTACAAGTGGGAGAA
GAGCCACAGTGCAAATCAACTCCAAGAGATTTATAAGCATTTAGCGAATGGTGAAGAGTTAAACGACGAGAGTGATCGTG
TTTCTATAGCTGGGAGAGTCGTTGCTCGTAGAGCGTTTGGGAAGCTTGCGTTTTTGACTCTGAGGGATGACTCTGGAACC
ATTCAGCTTTACTGTGAGAAGGAAAGGCTGTCAGATGAGCAGTTTGAACAGCTGAAGGCATTCATAGACATTGGTGATAT
TTTGGGTGCTAGTGGCTCAATGAAGAGGACTGAGAAAGGGGAACTTTCTATATGTGTGAGTTCTTTTTCAATTCTCACAA
AGTCTCTCCTTCCATTGCCTGACAAGTATCATGGTCTAACTGATATTGATAAACGTTACCGCCAAAGGTATGTGGATATG
ATTGCTAATCCTGAAGTGGCTGATGTGTTCCGCAAAAGGGCAAAAATAGTTTCAGAGATACGCAAGACAGTGGAGTCTTC
TGGATATCTGGAGGTTGAAACTCCAGTTCTTCAGGGGGCAGCTGGTGGAGCCGAAGCTAGACCCTTTGTAACGTATCATA
ACTCACTTGGAAGGGATCTTTACCTGAGGATTGCAACCGAGCTTCACTTGAAAAGAATGCTGGTTGGAGGGTTTGAGAAA
GTATACGAAATTGGTCGTATATTTAGAAACGAAGGCCTTTCAACACGTCACAATCCTGAATTCACAACCATCGAGATGTA
TGAAGCTTTTTCGGACTACCAAAGCATGATGGACATGGCAGAACTAATCGTCACTGGATGTGCAATGGCAGTTAATGGGA
AGCTAACAATTGATTATCAGGGAACAGAGATCTGCCTCGAGCGGCCTTGGAGGAGAGAAACCATGCACAATCTCGTTAAA
GAGGCAACAGGAATCGATTTCAGTGAGCTAGGGGAAGATCTCGGAAAGGCCAAAGACACAGTTCTGGTGGCACTTCAAGA
CGTGCTTGAGCACAAGGACAAATCTGGAATTGGAGCTTGCTCTTCTCTCGGCCATCTTCTTAATGAGGTGTTTGAAGTTG
TTGTAGAGCCAAAGCTTGTGCAGCCAACTTTTGTATTGGACTACCCAATCGAGATATCTCCCTTGGCCAAGCCACATCGC
GGTAATGCAGGTTTGACTGAAAGATTTGAGCTGTTCATCTGTGGCCGTGAAATGGCTAACGCATTCTCTGAATTGACTGA
TCCTGTGGACCAGAGGAGGCGGTTGGAAGAGCAAGTAAGGCAGCATAACGCAAAGCGAGCGGCGGCTGCAGCAGAAACTC
CTGAGGGAAAGGCAAAGAAAGATGATGATGATGATGATGAATCATATGAGGTGACACTAGACGAAGACTTTCTCACTGCT
CTAGAATACGGAATGCCTCCTGCTTCTGGAATGGGGCTTGGTATTGACAGGCTGGGGATGCTGTTGACAAACTCTGCGAG
TATAAGAGACGTCATTGCGTTTCCTGTTCTGAAAGTTCAGCAGTAA