Details for Kale Locus Bo5g132440

Position : C5 ( 5`- 41068199 .. 41069495 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132440

Protein [Map View]
MLNTQQLLEMAYCFPYGHLVRCLWEFMCLSIPDSYETLSSSDNDEYDDDDDGGGDKEKRTSAAEVLCMQSPVSLIPDPIE
RRLPGEKVAVPTKRSDSSIACYTYSGSRGYLKIGYDSRRSPIVMPKKSRPSIFHPQFDEREHIRSELYQFVYKPRERLAW
VYGPVIVD*

DNA
ATGTTGAATACTCAACAGCTTCTTGAGATGGCTTATTGCTTCCCGTATGGTCATCTCGTTCGCTGTCTATGGGAATTTAT
GTGTTTGTCCATACCTGATTCTTACGAGACTTTATCTTCTTCTGATAATGATGAGTACGACGATGATGATGATGGTGGTG
GTGATAAAGAGAAGAGAACATCAGCCGCGGAAGTTCTGTGCATGCAATCGCCCGTTTCTCTCATTCCAGATCCAATAGAG
CGTCGCTTGCCAGGAGAGAAGGTTGCCGTTCCTACAAAGAGAAGCGACAGTAGCATTGCTTGTTATACCTATTCTGGATC
GAGAGGTTACCTGAAGATCGGCTATGATTCCAGGAGGAGCCCAATTGTGATGCCAAAAAAGAGCAGACCGTCCATTTTCC
ACCCTCAGTTTGATGAGAGGGAACACATCCGGTCTGAGCTTTATCAATTTGTTTACAAGCCACGAGAAAGACTGGCGTGG
GTTTATGGTCCAGTAATTGTGGATTGA