Details for Kale Locus Bo5g132400

Position : C5 ( 5`- 41050305 .. 41052575 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132400

Protein [Map View]
MSTVFNIILESTNHLSTDSNCLASIKHLIPNLVLKNGNLVYQISALFNLCKINKRRQEHAAENGIIPHLMLFIMSDSPLK
QYALLLLCDMMAHASQNSREQLRAQGGLYFYLSLLDDEYWSVIALDSIAVCL*

DNA
ATGTCCACCGTCTTCAACATAATACTGGAGTCCACCAATCATTTATCCACTGATTCAAATTGCTTGGCGTCAATCAAACA
TTTGATCCCCAACCTTGTGCTCAAGAATGGGAATCTTGTTTATCAGATTAGTGCACTGTTCAATCTGTGCAAGATAAACA
AGAGGAGGCAAGAACACGCGGCTGAGAACGGAATCATACCACACCTGATGCTTTTCATCATGTCTGACTCTCCTCTAAAA
CAATATGCATTGCTGCTCCTATGTGATATGATGGCTCACGCATCGCAAAACTCAAGAGAGCAGTTAAGAGCTCAAGGCGG
TCTGTACTTTTACCTGAGTTTGCTGGATGATGAGTATTGGTCAGTGATAGCATTAGATTCAATTGCTGTTTGCTTATAA