Details for Kale Locus Bo5g132390

Position : C5 ( 5`- 41044894 .. 41045985 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132390

Protein [Map View]
MMTTPGGSGRFKPLPTAMYAGYSGTASSWVAKTSVSASGKRIQREMAELNVDPPPECSAGPKGDNLYHWIATIIGPSGTP
YEGGIFFLDMIFPSDYPFKPPKVVFKTRIYHCNVDTAGNLSVEILRDSWSPALTITKVLQAIRTIFLKPEPFNPALPVIA
RLYLSDREKHEEVAKEWTLRFAK*

DNA
ATGATGACGACACCAGGCGGAAGCGGGAGATTTAAGCCGTTACCGACGGCGATGTACGCCGGATACTCAGGAACGGCGTC
GTCTTGGGTAGCGAAGACATCGGTTTCCGCGTCCGGGAAGAGGATACAGAGAGAGATGGCTGAGCTTAACGTGGATCCGC
CTCCCGAATGCTCAGCTGGACCCAAAGGAGATAATCTCTACCATTGGATCGCCACCATCATTGGTCCCTCGGGGACTCCT
TATGAAGGAGGGATCTTTTTTCTGGATATGATTTTTCCGTCTGATTATCCTTTTAAACCACCAAAGGTGGTGTTCAAGAC
TCGGATCTACCATTGCAATGTCGACACTGCGGGGAACTTAAGTGTGGAGATTCTAAGAGACAGTTGGAGTCCGGCTCTTA
CAATCACTAAAGTCTTGCAAGCCATCAGAACCATCTTCTTAAAACCTGAGCCATTCAATCCAGCTTTACCGGTGATCGCA
CGGCTCTACTTGTCGGATAGAGAAAAGCACGAGGAGGTAGCTAAAGAATGGACATTGCGATTTGCCAAGTGA