Details for Kale Locus Bo5g132350

Position : C5 ( 5`- 41027977 .. 41029245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132350

Protein [Map View]
MESNPTIDHPETHEHTLTFIRKKNSFSCDACGLVGEFEINMYGCLPCNFFIHRDCIYLPKIIKLTRHSHRLLHTYHVPDC
NTKCRICNGSFVWGCGGYICTDKTCDYKLHSYCATRKATWDGRDLEQELEEISNSDQDVTSLKEVDGKTFRHFSHHHDLM
KLCVNGEKEGDERVCEACILPIGSGSFLGCKECDFALHATCANLPRKLEHTFHRHPLTLEVDIIEEGFFSCSQCERESCG
FMYRCCQEECEFKMDAKCASLADPLYNGAHQHPLTLLDSGACCYECDLYFDSTRATLPVLVKCNYDMHPLSLCFTQSFIW
YKPSLSCDACEKGINPDVQDIYVCFDCNTVVHVECAIGKYPYLKHGHTIELNGFEIEIASNNNISRPICHACHSICQDKL
FFRNKKNVTISFCSINCVTTSS*

DNA
ATGGAGTCGAATCCGACAATAGATCATCCAGAGACACATGAACATACGCTCACCTTCATTCGCAAAAAGAACTCTTTCAG
TTGTGATGCTTGCGGACTGGTCGGTGAGTTCGAGATAAACATGTACGGATGTTTGCCCTGCAACTTCTTTATCCACAGAG
ATTGTATCTATTTACCAAAGATTATAAAGCTCACTCGTCACTCACACCGCTTGCTTCATACTTATCACGTTCCTGATTGT
AACACGAAATGTCGAATTTGTAATGGTTCGTTTGTTTGGGGATGTGGAGGATATATTTGTACTGACAAGACATGTGATTA
TAAACTCCATTCATATTGTGCAACGCGTAAAGCTACGTGGGATGGCAGAGATTTGGAGCAAGAACTTGAAGAAATCAGTA
ACTCTGATCAAGATGTTACGTCGTTGAAGGAGGTAGATGGCAAAACGTTTCGCCATTTTAGTCACCACCATGATTTAATG
AAACTCTGTGTCAACGGTGAAAAAGAAGGAGACGAAAGAGTATGTGAAGCCTGCATCCTTCCCATTGGCTCCGGTAGTTT
CTTGGGTTGTAAAGAATGTGACTTTGCACTCCATGCCACTTGTGCAAATCTTCCTCGGAAGCTGGAACACACGTTTCACC
GTCATCCGCTAACCCTAGAGGTGGACATCATCGAAGAAGGGTTCTTCAGTTGCTCTCAATGTGAACGAGAATCATGTGGT
TTCATGTATCGGTGCTGCCAAGAGGAATGTGAGTTTAAAATGGATGCAAAGTGTGCTTCCCTTGCTGATCCATTATACAA
TGGAGCCCACCAACACCCTCTCACTCTATTAGACAGTGGGGCATGTTGTTACGAATGCGATTTATATTTTGATTCAACAC
GCGCAACTCTGCCAGTGTTAGTTAAATGCAACTATGACATGCACCCACTTAGCCTATGTTTTACACAATCATTTATATGG
TACAAGCCGTCGTTGTCTTGTGATGCATGTGAAAAAGGAATAAACCCTGATGTTCAAGATATCTACGTCTGCTTCGATTG
CAACACTGTTGTACACGTTGAGTGTGCAATAGGGAAATACCCGTATCTAAAACATGGCCATACGATCGAACTGAACGGTT
TTGAGATTGAGATTGCATCCAACAACAATATTTCTCGGCCTATATGTCATGCATGTCATTCTATATGTCAGGATAAACTG
TTTTTCAGGAATAAGAAAAATGTCACGATCTCTTTCTGTTCTATCAACTGTGTAACAACCTCTTCGTAG