Details for Kale Locus Bo5g132320

Position : C5 ( 5`- 40977908 .. 40980084 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132320

Protein [Map View]
MGVSFSYPFTKQEDVEVALDSVTVKSISFGDEDECKTPKRSVNFNDRTLEPTILKSIGSGGKMVVEKSVSFKGMQLERTI
ENGFEIDNAEIARELSVLDPKNPKHEAAIKLQKVYKSFRTRRKLADCAVLVEQSWWKLLDFAELKRSSISFFDIEKHETA
ISRWSRARTRAAKVGKGLSKNGKAQKLALQHWLEAIDPRHRYGHNLHFYYNKWLHCQSREPFFYWLDIGEGKEVNLVEKC
PRLKLQQQCIKYLGPMERKAYEVVVEEGKFFYKTSGEMLHSSMEESDSKWIFVLSTSKVLYVGKKKKGTFQHSSFLAGGA
TVAAGRLVVESGVLKAVWPHSGHYQPTEDNFLDFLSFLRENNVDITDVKMSPTDEDEFSLYKQRSTHMRNHSLEEDLESE
KTIILQDKADPIEEEEEEETTPVTANIETPKKMDSTQVSEDYDSGDDEEEEEEIFNLEQEQSSPRGGEETRESEVVKIPE
ESILKRINSKKESRSFQLGKQLSCKWTTGAGPRIGCVRDYPSELQFQALEQVHLSPRSASVSKLCFSSLSHTQTPQMSPL
WRGMSLPADIITHS*

DNA
ATGGGAGTCTCATTCTCCTATCCGTTCACCAAGCAAGAAGACGTCGAGGTTGCTCTAGACTCCGTCACCGTTAAGTCCAT
AAGCTTCGGTGATGAGGACGAGTGCAAAACTCCCAAGAGATCCGTTAACTTCAATGACAGAACTCTCGAGCCCACGATCT
TGAAATCTATTGGATCGGGTGGTAAAATGGTTGTTGAGAAGTCTGTCAGCTTCAAAGGGATGCAGCTCGAGAGAACGATA
GAGAATGGCTTCGAGATAGACAATGCAGAGATTGCTAGAGAACTCTCAGTTCTTGATCCGAAGAACCCTAAACACGAAGC
TGCTATTAAGTTACAGAAAGTTTACAAGAGCTTCCGTACGAGGAGAAAGCTGGCTGATTGTGCAGTGCTCGTGGAGCAAA
GCTGGTGGAAGCTATTGGATTTTGCTGAGCTGAAGAGAAGTTCTATATCTTTCTTTGATATTGAGAAGCACGAAACCGCG
ATTTCGAGGTGGTCTAGAGCTAGGACTAGAGCAGCTAAGGTTGGTAAAGGATTGTCCAAGAATGGAAAAGCACAAAAGCT
TGCTCTACAACATTGGCTTGAAGCTATTGACCCCAGACATCGGTATGGACACAACCTGCACTTTTACTACAACAAATGGC
TCCACTGTCAGAGTAGAGAACCTTTCTTCTACTGGCTTGATATTGGAGAGGGGAAAGAAGTAAATCTTGTGGAGAAGTGT
CCTCGTTTGAAACTTCAGCAACAGTGCATCAAGTACCTTGGTCCGATGGAAAGGAAAGCTTATGAGGTTGTTGTGGAAGA
AGGCAAGTTCTTTTATAAGACCAGTGGAGAAATGCTTCATTCTTCAATGGAAGAAAGTGATTCTAAATGGATTTTTGTGC
TCAGCACGTCGAAAGTGTTATATGTTGGGAAGAAGAAGAAGGGTACCTTTCAACATTCAAGCTTCTTAGCTGGAGGAGCT
ACTGTTGCTGCAGGGAGATTAGTTGTTGAGAGTGGTGTTCTTAAGGCTGTTTGGCCACACAGTGGACATTATCAACCTAC
AGAAGATAATTTCTTGGACTTTCTCTCTTTCTTAAGAGAGAACAATGTTGATATCACTGATGTAAAGATGAGTCCTACAG
ATGAAGATGAGTTTTCTCTTTACAAACAAAGAAGCACTCACATGAGAAACCATTCTCTGGAAGAGGATTTGGAGTCTGAA
AAGACCATTATCTTGCAAGACAAGGCTGATCCAATAGAAGAAGAAGAAGAAGAAGAAACAACTCCGGTAACGGCTAATAT
CGAAACACCAAAAAAGATGGATTCTACTCAAGTATCTGAAGACTACGATTCTGGTGATGATGAGGAGGAAGAGGAAGAGA
TTTTTAACTTAGAACAAGAACAGAGCTCACCAAGAGGAGGAGAAGAAACCAGAGAGAGTGAAGTAGTGAAGATTCCAGAA
GAATCAATCCTAAAAAGGATCAATTCAAAGAAGGAAAGTAGATCTTTCCAACTTGGGAAACAACTATCTTGCAAGTGGAC
AACAGGTGCAGGACCAAGGATAGGCTGTGTAAGAGATTACCCATCAGAGCTTCAGTTTCAAGCACTTGAACAAGTCCACT
TGTCTCCGAGAAGCGCTTCTGTTTCAAAACTCTGTTTCTCTTCCTTGTCTCACACGCAAACGCCTCAGATGTCACCGTTA
TGGCGAGGAATGTCATTACCTGCAGATATCATCACACATTCATAA