Details for Kale Locus Bo5g132290

Position : C5 ( 5`- 40963292 .. 40964836 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132290

Protein [Map View]
MAPTLSTANFADPAEVTEFVVNKGNGVKGLSETGIKALPDQYIQPFEERLINKFVNETDEAIPVIDMSDPNGNKVAEAIC
DAAEKWGFFQVINHGVPLDVLDNVKAATHRFFNLPVEEKSRFTKENSLTTNVRFGTSFSPRAEKALEWKDYLSLFFVSEA
EAEQFWPDVCKNEALEYMNKSKTMVRKLLEYLGKNLNVKELDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSS
LTILLQDQIGGLHVRSLSSGNWVHVPPVPGSFVINIGDAMQILSNGRYKSVEHRVLANGSNNRISVPIFVNPKPESVIGP
LPEVIANGEEPIYKDVVYSDYVRYFFKKAHDGKKTVDFAKI*

DNA
ATGGCTCCAACTCTCTCTACCGCCAACTTCGCAGACCCAGCGGAAGTAACCGAGTTCGTGGTCAACAAAGGCAATGGCGT
AAAGGGTTTATCAGAAACAGGAATCAAAGCTCTTCCGGACCAATACATTCAACCCTTTGAAGAGCGTCTCATCAACAAGT
TCGTCAACGAGACAGACGAAGCTATACCAGTCATCGACATGTCGGACCCCAACGGGAACAAAGTCGCTGAAGCTATCTGT
GACGCTGCTGAGAAATGGGGTTTCTTTCAGGTGATCAACCATGGAGTTCCTTTGGATGTTCTTGACAACGTGAAGGCTGC
GACTCACAGGTTCTTTAATCTTCCTGTTGAGGAGAAGAGCAGGTTCACAAAGGAGAATTCTCTGACGACCAATGTTAGGT
TCGGTACTAGTTTCAGTCCTCGTGCTGAGAAAGCTCTCGAGTGGAAAGATTATCTCAGTCTCTTCTTTGTGTCCGAAGCT
GAAGCTGAACAGTTTTGGCCTGATGTTTGCAAAAATGAAGCTCTAGAGTACATGAACAAGTCCAAGACAATGGTGAGGAA
GCTTCTAGAGTATCTAGGAAAGAATCTCAACGTGAAAGAGCTAGACGAGACCAAAGAGTCACTCTTCATGGGCTCAATCC
GAGTCAACCTCAACTACTATCCCATCTGTCCTAACCCTGACCTAACCGTTGGCGTTGGTCGTCACTCAGACGTCTCTTCC
CTCACCATTCTCTTACAAGACCAAATCGGTGGCCTCCACGTGCGTTCTCTATCCTCAGGGAACTGGGTTCACGTGCCACC
GGTTCCCGGATCCTTTGTGATCAACATAGGAGACGCCATGCAGATCTTGAGCAATGGTCGCTACAAGAGCGTGGAGCATC
GGGTCTTAGCTAATGGTAGCAACAACAGAATCTCTGTTCCTATCTTTGTGAATCCAAAACCAGAGTCTGTGATTGGTCCT
CTTCCTGAGGTGATTGCAAATGGAGAGGAACCGATTTATAAAGACGTTGTGTACTCTGATTACGTCAGGTACTTCTTCAA
GAAGGCACATGATGGTAAGAAAACCGTTGACTTCGCCAAGATATGA