Details for Kale Locus Bo5g132250

Position : C5 ( 5`- 40930437 .. 40934053 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132250

Protein [Map View]
MPELRRRVRRGRVPDALAPNQQPADKNQRKSNGKAVAVGVTERPRTRLAARRLKEEDKVILQENLKDSDKKKGKEVVVEE
EEEEEKEVMAIGNDSGGSNKAAAQEEEGNTAPFPERVQVGGSPLYKVERKLGKGGFGQVFVGRRISGGNDRSAGASILEV
ALKFEHRSSKGCNYGPPHEWQVYNTLGGSHGVPRVHFKGRQGDYYIMVMDILGPSLWDIWNTSGQAMSSEMVACIAVESL
SILEKMHAKGYVHGDVKPENFLLGQPSTSQEKKLFLVDLGLATKWREGGGNGQHVEYDQRPDMFRGTVRYASAHAHLGRT
ASRRDDLESLAYTLIFLHRGRLPWQGYQGDNKSFLVCKKKMATSPDMLCCFCPAPFKQFLEIVVNMKFDEEPNYGKLVSL
FQELLGENPAIRPINTEGAQKIIFQVGQKRGRLSIGEEEEDAPRKKVRLGVPATQWISIYNARQPMKQRYHYNVADSRLA
QHIERGIADGLLISCVSSCSNLWALIMDAGTGFTNQVYELSPVFLHKEWIMEQWEKNYYISSIAGATNGSSLVVMSKGTQ
YSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSRWGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATT
DQAALILSIPRRRLADETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTVS*

DNA
ATGCCTGAGCTTCGCCGTCGAGTCCGCCGTGGCCGTGTCCCCGACGCTTTAGCTCCGAATCAACAGCCTGCGGATAAGAA
TCAGAGGAAGAGTAACGGAAAAGCGGTTGCCGTCGGAGTTACAGAGAGGCCGAGGACGAGATTGGCGGCGAGGAGATTGA
AAGAGGAAGATAAGGTGATACTTCAGGAGAATCTGAAGGATAGCGATAAGAAGAAGGGTAAAGAGGTTGTGGTTGAAGAA
GAAGAAGAAGAAGAGAAGGAAGTTATGGCGATTGGTAACGATAGTGGTGGCTCTAACAAGGCGGCGGCTCAGGAAGAAGA
AGGAAACACTGCTCCTTTCCCTGAAAGGGTTCAAGTTGGAGGATCACCGCTTTATAAGGTTGAGAGGAAGCTGGGGAAGG
GTGGTTTTGGTCAAGTGTTCGTAGGACGTCGTATTAGTGGTGGTAATGATCGTAGTGCAGGAGCTAGCATCTTGGAGGTT
GCTCTGAAGTTTGAGCATCGAAGCAGCAAGGGTTGCAACTATGGTCCTCCACATGAGTGGCAGGTGTACAATACGTTGGG
TGGCAGCCATGGAGTACCTAGAGTGCACTTCAAAGGGAGACAAGGAGACTATTATATTATGGTAATGGACATACTCGGGC
CTAGCTTGTGGGATATATGGAATACTTCAGGGCAAGCAATGTCCTCGGAAATGGTAGCTTGCATTGCAGTTGAATCACTG
TCCATCCTTGAAAAGATGCATGCTAAAGGTTATGTGCATGGAGATGTTAAGCCAGAAAATTTCTTACTCGGGCAGCCTTC
CACGTCTCAAGAGAAAAAGCTGTTTCTTGTTGATTTGGGACTAGCAACAAAGTGGAGAGAAGGAGGTGGTAACGGACAAC
ATGTTGAATATGACCAACGTCCCGATATGTTTAGGGGGACAGTTAGATACGCAAGTGCACATGCTCACTTGGGGAGAACT
GCTAGCAGAAGGGATGATCTCGAATCATTGGCATATACACTGATCTTCCTTCACCGAGGTAGATTGCCATGGCAAGGATA
TCAGGGAGATAACAAGTCATTCCTCGTTTGCAAAAAGAAGATGGCAACATCGCCGGATATGCTTTGTTGTTTCTGTCCCG
CTCCTTTCAAGCAATTTCTTGAGATCGTGGTAAATATGAAATTTGACGAGGAACCTAACTATGGGAAGTTAGTATCTCTG
TTTCAAGAACTCTTGGGGGAAAACCCGGCAATTAGGCCTATTAACACGGAGGGTGCTCAAAAGATCATTTTTCAAGTTGG
ACAGAAGCGAGGTAGGTTGAGCATTGGGGAAGAAGAAGAAGATGCCCCTAGGAAAAAAGTCCGTCTAGGAGTCCCTGCAA
CACAATGGATATCGATTTACAATGCCAGGCAACCAATGAAGCAGAGGTACCATTATAATGTAGCTGATTCAAGGCTGGCA
CAGCATATCGAGAGAGGTATCGCAGATGGTTTGTTAATAAGCTGTGTATCATCATGTTCGAATCTATGGGCATTAATAAT
GGATGCTGGAACTGGCTTCACAAACCAAGTCTACGAACTTTCTCCTGTCTTCTTGCATAAGGAATGGATAATGGAACAGT
GGGAGAAGAATTACTACATAAGTTCTATTGCTGGTGCAACCAATGGAAGCTCCTTAGTTGTCATGTCAAAAGGTACGCAG
TATTCACAGCAGTCTTACAAAGTAAGTGATTCATTCCCATTCAAGTGGATAAACAAGAAGTGGAGAGAAGGCTTCCATGT
AACCTCTATGGCAACAGCTGGGAGTCGATGGGGTGTTGTTATGTCCCGCAATTCTGGTTACAGTGAGCAGGTTGTGGAAC
TGGATTTTCTGTATCCGAGTGAAGGCGTCCACAGGCGTTGGGATGGTGGATACAGAATTACATCAACCGCAGCAACAACT
GATCAAGCTGCTCTAATTTTAAGCATCCCACGGCGTAGACTGGCTGATGAGACGCAAGAGACATTGCGTACCTCTCAGTT
CCCTAGCACACATGTCAAGGAAAAATGGGGAAAGAATCTCTACCTGGCATCTTTAAGCTATGGCCGAACTGTCTCTTGA