Details for Kale Locus Bo5g132240

Position : C5 ( 5`- 40916015 .. 40918914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g132240

Protein [Map View]
MSRLLKRGKQEKPLVSDGAEKVIVAVKASREIPKTALIWALTHVVQPGDCITLIVVVPSQNSGRKLWGFTRSFPMFAGDC
ASGHRKPHSEALPAIKSDLTDTCSQMILQLHDVYDPNKINVNIKIVSGSPYGAVAAESKKAQANWVVLDKHLKQEEKRCM
DELQCNIVVMKRSQAKVLRLNLVAEKGSPPLPTGQEAASEKDTKNTKGSSDSNRELPVTPTSSPELGTPFTSTEAGTSSV
SSSDPGTSPFFTLGTSGYMKKDGALVIKENDDSASETDSESQSLASTSMRFQPWISEYVSTHRHSSLDADDRAQISTTKA
LLEKFSKLDVKAGLSSSSRSDLEFSGNVRDAISLSRNAPPGPPPLCSICQHKAPVFGKPPRLFSYAELELATGGFSQANF
LAEGGYGSVHRGVLPEGQVVAVKQHKLASSQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEDRRRLLVYEYICNGSLDSHL
YGRQRETLEWPARQKIAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDNEPLVGDFGLARWQPDGELGVETRVIGTF
GYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAIDITMPKGQQCLTEWARPLLEEYAVEELIDPKLGDCFVESEVICM
LHAASLCIRRDPHLRPRMSQVLRILEGDMIMDGNYCSTPGSEAGNRSGRLWADHYSSGQLTKDGFGSDRFSERLSVETPR
LALREKERGQRLELNNHKKQY*

DNA
ATGAGTCGTTTACTGAAGCGAGGGAAGCAGGAAAAGCCTCTAGTATCTGATGGGGCTGAGAAGGTTATCGTCGCTGTTAA
AGCCTCTAGGGAGATTCCAAAGACAGCTTTGATTTGGGCTTTGACTCATGTCGTTCAGCCTGGGGACTGCATTACCCTCA
TCGTTGTTGTCCCTTCTCAAAACTCCGGAAGAAAACTTTGGGGTTTCACTAGGAGTTTCCCTATGTTTGCTGGAGATTGT
GCAAGTGGTCACCGCAAACCACATTCTGAAGCACTTCCAGCGATTAAAAGTGATCTCACTGACACTTGTTCCCAAATGAT
TCTCCAGCTTCATGATGTCTATGATCCCAATAAGATAAATGTCAATATTAAGATTGTTTCTGGATCACCCTATGGAGCTG
TTGCTGCTGAGTCTAAGAAAGCACAAGCTAATTGGGTCGTCCTAGACAAACACCTCAAGCAGGAAGAGAAACGGTGTATG
GATGAATTGCAATGCAACATTGTGGTGATGAAGCGTTCTCAGGCAAAAGTTCTACGCTTAAATTTGGTTGCTGAGAAAGG
CTCTCCTCCTTTACCAACCGGACAAGAAGCAGCATCTGAAAAAGACACAAAGAACACAAAAGGATCGTCAGATTCTAACA
GAGAACTACCTGTAACTCCCACTAGCAGCCCTGAGCTGGGGACACCATTCACAAGCACAGAAGCTGGGACTTCATCAGTG
TCAAGCTCTGACCCAGGAACTTCACCGTTCTTCACCTTGGGAACGAGTGGGTACATGAAGAAAGATGGAGCATTGGTCAT
CAAGGAGAACGATGATTCCGCCTCCGAAACAGATAGCGAAAGCCAATCATTAGCGTCAACGAGTATGAGATTCCAGCCGT
GGATATCAGAATATGTTAGCACACATCGCCATTCATCCCTAGACGCCGATGACAGGGCTCAAATATCCACTACAAAGGCT
TTGCTTGAGAAGTTCTCTAAGCTGGATGTAAAAGCTGGATTGTCCTCTAGCAGCAGGAGTGATCTGGAGTTTAGTGGAAA
CGTGAGAGATGCTATATCACTCTCTCGGAATGCTCCTCCTGGCCCGCCTCCTCTCTGTTCCATCTGCCAGCACAAGGCCC
CGGTGTTTGGGAAACCACCTAGGCTGTTTTCATACGCCGAGCTAGAGCTTGCAACAGGTGGGTTCTCACAGGCTAACTTC
TTGGCAGAGGGTGGATATGGATCTGTTCATCGAGGTGTACTACCGGAAGGCCAGGTAGTTGCAGTAAAGCAGCACAAACT
GGCGAGTTCTCAAGGAGATGTAGAGTTTTGTTCCGAAGTGGAAGTTCTCAGCTGTGCTCAGCATAGGAACGTTGTTATGC
TAATTGGTTTCTGCATTGAAGACAGGAGACGGCTCTTGGTTTATGAGTACATATGCAATGGCTCACTTGACTCCCATCTA
TACGGTCGTCAAAGGGAGACACTAGAATGGCCAGCACGGCAAAAGATTGCTGTTGGAGCTGCAAGAGGTCTTCGGTATCT
TCATGAAGAGTGCAGAGTTGGTTGTATTGTCCACAGAGACATGCGTCCTAACAACATCCTCATCACTCATGATAACGAGC
CACTGGTCGGAGATTTTGGTCTAGCGAGATGGCAGCCTGACGGAGAACTAGGTGTAGAAACACGAGTGATAGGTACCTTC
GGCTATTTAGCTCCAGAGTATGCTCAAAGCGGGCAGATCACAGAGAAAGCGGATGTCTACTCGTTCGGGGTTGTTTTAGT
TGAGCTAGTCACAGGCCGCAAAGCCATTGACATTACTATGCCGAAAGGACAGCAATGCCTCACTGAATGGGCACGTCCAC
TACTTGAAGAATATGCTGTAGAAGAACTTATAGATCCAAAGCTTGGGGACTGTTTTGTAGAAAGCGAGGTCATTTGTATG
CTTCACGCAGCTTCCTTGTGTATACGTAGAGACCCACATTTGAGGCCACGCATGTCTCAGGTGTTGCGTATACTGGAAGG
AGATATGATAATGGATGGGAACTACTGCTCAACTCCAGGGTCAGAGGCAGGCAACAGAAGCGGGCGGTTGTGGGCTGATC
ATTACAGTAGCGGTCAGCTAACAAAAGATGGGTTTGGGTCGGATAGGTTCAGTGAAAGGCTGTCTGTTGAAACGCCAAGA
CTAGCTTTAAGGGAAAAGGAAAGAGGTCAGAGGTTGGAACTAAACAACCACAAGAAGCAATACTAA